Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4595
Gene name
LocationContig_2328:903..2556
Strand+
Gene length (bp)1653
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 4.8E-22 78 235
PF13649 Methyltransf_25 Methyltransferase domain 2.5E-11 86 173
PF13847 Methyltransf_31 Methyltransferase domain 4.4E-08 84 186
PF08241 Methyltransf_11 Methyltransferase domain 3.5E-07 87 175

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 80 234 3.0E-07

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4595
MSDEAAGGTAPWASSIVHCQFLNIAGVDRRRTSPATTNGRIFGGYVLPNDEVENERLDLQHHLCTLTLSGKLYTC
PAGRERPLDRVLDAGTGTGIWAMDLADEHPESHVTGVDLSPIQPSFVPPNVSFYIDDIEDDWTFTYKFDLVYARM
LTASISDWPRFFQQSFENLNPGGWIEILDVHLQLKSDDGTIPENCAVAKWGDYMLEAAAKLNRPLDSMTFYKQQL
EAVGFSNVTQNLYKWPTNSWPKDPKFKELGMWTYENLGNGASGLSMALFTRALGWKSEEVEVFLVNVRKQMRDRS
IHAYWPIYVVYAQKPEY*
Coding >Hirsu2|4595
ATGTCTGACGAGGCCGCGGGCGGCACGGCGCCCTGGGCATCGAGCATAGTCCATTGCCAGTTCCTCAACATCGCT
GGCGTCGACCGGAGACGGACGAGCCCAGCGACGACTAACGGGCGCATCTTTGGAGGATACGTCCTGCCAAATGAC
GAGGTCGAGAACGAGCGTCTAGACCTGCAACATCACCTCTGCACCTTGACCCTGAGTGGTAAGCTGTATACGTGC
CCTGCCGGGCGAGAACGACCGCTCGACCGCGTCTTGGATGCCGGGACCGGTACGGGCATCTGGGCGATGGATCTA
GCCGACGAGCATCCCGAAAGCCATGTCACCGGGGTCGACCTCAGCCCGATACAACCGTCATTCGTCCCGCCCAAC
GTATCCTTCTACATCGACGACATCGAGGACGATTGGACGTTTACATACAAGTTTGATCTCGTCTACGCGCGCATG
TTGACGGCGTCGATATCGGACTGGCCGAGGTTCTTCCAGCAAAGCTTTGAAAACCTCAACCCGGGGGGCTGGATC
GAGATTCTCGATGTCCATCTCCAGCTCAAGAGCGACGACGGGACAATACCAGAGAACTGCGCAGTGGCCAAGTGG
GGAGACTACATGCTGGAGGCGGCGGCCAAGCTGAACCGGCCGCTGGACAGCATGACGTTCTACAAGCAGCAGCTG
GAGGCGGTCGGGTTCAGCAACGTGACGCAGAACCTGTACAAGTGGCCGACCAACTCGTGGCCAAAGGACCCCAAG
TTCAAAGAGTTAGGCATGTGGACGTACGAGAACCTGGGCAACGGCGCGTCCGGGCTGAGCATGGCCCTCTTCACC
CGGGCGCTCGGCTGGAAGTCGGAGGAGGTGGAGGTGTTTCTGGTCAACGTGCGGAAGCAGATGAGGGACCGCTCC
ATCCACGCGTATTGGCCGATATACGTGGTATACGCGCAGAAGCCCGAGTACTAA
Transcript >Hirsu2|4595
ATGTCTGACGAGGCCGCGGGCGGCACGGCGCCCTGGGCATCGAGCATAGTCCATTGCCAGTTCCTCAACATCGCT
GGCGTCGACCGGAGACGGACGAGCCCAGCGACGACTAACGGGCGCATCTTTGGAGGATACGTCCTGCCAAATGAC
GAGGTCGAGAACGAGCGTCTAGACCTGCAACATCACCTCTGCACCTTGACCCTGAGTGGTAAGCTGTATACGTGC
CCTGCCGGGCGAGAACGACCGCTCGACCGCGTCTTGGATGCCGGGACCGGTACGGGCATCTGGGCGATGGATCTA
GCCGACGAGCATCCCGAAAGCCATGTCACCGGGGTCGACCTCAGCCCGATACAACCGTCATTCGTCCCGCCCAAC
GTATCCTTCTACATCGACGACATCGAGGACGATTGGACGTTTACATACAAGTTTGATCTCGTCTACGCGCGCATG
TTGACGGCGTCGATATCGGACTGGCCGAGGTTCTTCCAGCAAAGCTTTGAAAACCTCAACCCGGGGGGCTGGATC
GAGATTCTCGATGTCCATCTCCAGCTCAAGAGCGACGACGGGACAATACCAGAGAACTGCGCAGTGGCCAAGTGG
GGAGACTACATGCTGGAGGCGGCGGCCAAGCTGAACCGGCCGCTGGACAGCATGACGTTCTACAAGCAGCAGCTG
GAGGCGGTCGGGTTCAGCAACGTGACGCAGAACCTGTACAAGTGGCCGACCAACTCGTGGCCAAAGGACCCCAAG
TTCAAAGAGTTAGGCATGTGGACGTACGAGAACCTGGGCAACGGCGCGTCCGGGCTGAGCATGGCCCTCTTCACC
CGGGCGCTCGGCTGGAAGTCGGAGGAGGTGGAGGTGTTTCTGGTCAACGTGCGGAAGCAGATGAGGGACCGCTCC
ATCCACGCGTATTGGCCGATATACGTGGTATACGCGCAGAAGCCCGAGTACTAA
Gene >Hirsu2|4595
ATGTCTGACGAGGCCGCGGGCGGCACGGCGCCCTGGGCATCGAGCATAGTCCATTGCCAGTTCCTCAACATCGCT
GGCGTCGAGTATCATGAGATATCGCGAAGAGAACGGGCGGACATATCACGCGTTTCGAGCCGGCAGTATGCGCTC
CCACTTCCCCCCACCCCCTCCCTTCTCTCCCCTCCCCCCGTCCCCCGCTTCCCAAGCCGGAGACGGACGAGCCCA
GCGACGACTAACGGGCGCATCTTTGGAGGATACGTCCTGCCAAATGACGAGGTAGGCCGGGGTCGACACACTTCG
GGTAACCGCGGCGGCGGCTAACGGGCCAAGCACACAGGTCGAGAACGAGCGTCTAGGTAGGCCGCCGAGACAGCC
GTCCAGGAGAAGAACAAAGCTAAGGACGGGACGCCTCCACCCACAGACCTGCAACATCACCTCTGCACCTTGACC
CTGAGTGGTAAGCTGTATACGTGCCCTGCCGGGCGAGAACGACCGCTCGACCGCGTCTTGGATGCCGGGACCGGT
ACGGGCATCTGGGCGATGGATCTAGGTACGAGACCCGATCGGCGAGGGCCCATGGGCCCAGCGCGCGCTGACGGC
CAGCCTCAGCCGACGAGCATCCCGAAAGCCATGTACGTGGACCGACAATACAGGCGGCGCCGAGGACGGAAAGCT
CAAACGTGTCCAGGTCACCGGGGTCGACCTCAGCCCGATACAACCGTCATTGTACGTCGTGGGCCGTCGGTCGGA
GACGACGACGGCGGATGTGTGCTGACGGGAGCCTTCGTGTTTGCAGCGTCCCGCCCAACGTATCCTTCTACATCG
ACGACATCGAGGACGATTGGACGTTTACATACAAGTTTGATCTCGTCTACGCGCGCATGTTGACGGCGTCGATAT
CGGACTGGCCGAGGTTCTTCCAGCAAAGCTTTGAGTAATGCCCCTGCCCTCGCCCTGGACGCGCCCTCATCATTG
GTGGAGGGGGGCAGCGTTTGCAATCGTCGCGCGTCATCGGACCTCATTCTGACATGTTGTCGGGGCGGGACAGAA
ACCTCAACCCGGGGGGCTGGATCGAGATTCTCGATGTCCATCTCCAGCTCAAGAGCGACGACGGGACAATACCAG
AGAACTGCGCAGTGGCCAAGTGGGGAGACTACATGCTGGAGGCGGCGGCCAAGCTGAACCGGCCGCTGGACAGCA
TGACGTTCTACAAGCAGCAGCTGGAGGCGGTCGGGTTCAGCAACGTGACGCAGAACCTGTACAAGTGGCCGACCA
ACTCGTGGCCAAAGGACCCCAAGTTCAAAGAGTTAGGTAGGTGGCGAGGACTCATGCAGGGATCGACGTGCCGAG
GCGGCAACGGCGGCTGACGGGCGACGGCGATGTGGTGCAGGCATGTGGACGTACGAGAACCTGGGCAACGGCGCG
TCCGGGCTGAGCATGGCCCTCTTCACCCGGGCGCTCGGCTGGAAGTCGGAGGAGGTGGAGGTGTTTCTGGTCAAC
GTGCGGAAGCAGATGAGGGACCGCTCCATCCACGCGTATTGGCCGATGTGAGTTTGCCCGCCCGCGACGAATGAA
GGGGTTGCATGACGGCTCACACCGGACGTGATCCAACGATGCAGATACGTGGTATACGCGCAGAAGCCCGAGTAC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail