Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|459
Gene name
LocationContig_1091:5423..7487
Strand+
Gene length (bp)2064
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10513 EPL1 Enhancer of polycomb-like 4.9E-19 7 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S747|EPL1_NEUCR Enhancer of polycomb-like protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=epl-1 PE=3 SV=1 1 515 0.0E+00
sp|Q4I5V3|EPL1_GIBZE Enhancer of polycomb-like protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EPL1 PE=3 SV=2 1 545 0.0E+00
sp|Q4WDF1|EPL1_ASPFU Enhancer of polycomb-like protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=epl1 PE=3 SV=1 5 513 4.0E-126
sp|Q5AYR3|EPL1_EMENI Enhancer of polycomb-like protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=epl1 PE=3 SV=1 5 513 3.0E-121
sp|Q6CEV5|EPL1_YARLI Enhancer of polycomb-like protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EPL1 PE=3 SV=1 5 305 4.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S747|EPL1_NEUCR Enhancer of polycomb-like protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=epl-1 PE=3 SV=1 1 515 0.0E+00
sp|Q4I5V3|EPL1_GIBZE Enhancer of polycomb-like protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EPL1 PE=3 SV=2 1 545 0.0E+00
sp|Q4WDF1|EPL1_ASPFU Enhancer of polycomb-like protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=epl1 PE=3 SV=1 5 513 4.0E-126
sp|Q5AYR3|EPL1_EMENI Enhancer of polycomb-like protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=epl1 PE=3 SV=1 5 513 3.0E-121
sp|Q6CEV5|EPL1_YARLI Enhancer of polycomb-like protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EPL1 PE=3 SV=1 5 305 4.0E-55
sp|Q752Q3|EPL1_ASHGO Enhancer of polycomb-like protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EPL1 PE=3 SV=2 2 309 1.0E-45
sp|P43572|EPL1_YEAST Enhancer of polycomb-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPL1 PE=1 SV=1 5 309 5.0E-45
sp|Q9UU94|EPL1_SCHPO Enhancer of polycomb-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=epl1 PE=3 SV=1 2 491 5.0E-43
sp|Q6CIN8|EPL1_KLULA Enhancer of polycomb-like protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EPL1 PE=3 SV=1 1 309 3.0E-40
sp|Q6FLZ0|EPL1_CANGA Enhancer of polycomb-like protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EPL1 PE=3 SV=1 3 306 3.0E-38
sp|P0CN59|EPL1_CRYNB Enhancer of polycomb-like protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EPL1 PE=3 SV=1 1 307 3.0E-25
sp|P0CN58|EPL1_CRYNJ Enhancer of polycomb-like protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EPL1 PE=3 SV=1 1 307 3.0E-25
sp|Q9H2F5|EPC1_HUMAN Enhancer of polycomb homolog 1 OS=Homo sapiens GN=EPC1 PE=1 SV=1 1 286 5.0E-21
sp|Q6BNX0|EPL1_DEBHA Enhancer of polycomb-like protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EPL1 PE=3 SV=2 186 413 5.0E-21
sp|Q5AAG1|EPL1_CANAL Enhancer of polycomb-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EPL1 PE=3 SV=1 183 384 2.0E-20
sp|Q8C9X6|EPC1_MOUSE Enhancer of polycomb homolog 1 OS=Mus musculus GN=Epc1 PE=1 SV=1 1 286 2.0E-20
sp|Q8C0I4|EPC2_MOUSE Enhancer of polycomb homolog 2 OS=Mus musculus GN=Epc2 PE=2 SV=2 1 286 1.0E-19
sp|Q52LR7|EPC2_HUMAN Enhancer of polycomb homolog 2 OS=Homo sapiens GN=EPC2 PE=1 SV=2 1 286 1.0E-19
sp|Q66JA8|EPC2_XENLA Enhancer of polycomb homolog 2 OS=Xenopus laevis GN=epc2 PE=2 SV=1 1 286 3.0E-19
sp|Q6DJR9|EPC2_XENTR Enhancer of polycomb homolog 2 OS=Xenopus tropicalis GN=epc2 PE=2 SV=1 1 286 2.0E-18
sp|Q5AAG1|EPL1_CANAL Enhancer of polycomb-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EPL1 PE=3 SV=1 1 167 5.0E-09
sp|Q6BNX0|EPL1_DEBHA Enhancer of polycomb-like protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EPL1 PE=3 SV=2 2 158 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|459
MSSRKVRVKKLSVKTTLPVLREDQIDPSEYEALTTDNLIATGVEQAEENEYHLQTILKEAGTSNDQEIPVPPPQE
SDINYDELYPSAFNQPSSYIRFSQTVEECISCQYDMTSEDYDFLKSYTDSGPAGGPLSEDDFERIMEVFEDTAAE
QTPYASVDNTVVAYDMMVPALNHLGSASVLQHAKAIYEYWRTRRQGMGNKPLHPSLKFETHQETDDTDPYVCFRR
REARQTRKTRARDSKIAETLKRLRRELEDGRQLILMTYERELMKRDLLQSDMAVFEGRARLKQTKIKLGIKGEED
DLVNQKPQKRKAAEPPAAQRPSGTQLRAPARPDGRSVEQELVLLSDLLTQKERELREEIESKVQNHRRWNQNHID
LTRDPLSPVKEQGMELKFRPAKTQYLMTPPASTASESMDVDEEVAEPMAVDRRESPVFQFRAGSVTGEQAHARQP
SFRRRIGRLQRLWIDRRGMASPPRETDEYSDRWKYDSDDDDVEPPVYEVDPFDTRALKFRATIPLGQSMYPRGRP
QMAPDGSSGGPAMGRVLPAPPTAQATAAQAQVHSQAQAVQAQAQAQAQAQAQLQLHQTQAPTQIQTQAQTAA*
Coding >Hirsu2|459
ATGTCCTCCCGCAAGGTTCGAGTCAAGAAGTTGAGCGTCAAGACAACGCTGCCTGTCCTCCGAGAGGACCAGATC
GACCCTTCCGAATACGAGGCGCTCACCACCGACAACCTCATCGCCACCGGTGTCGAGCAGGCTGAGGAAAATGAA
TACCATCTGCAGACCATCCTCAAAGAGGCCGGGACCAGCAACGATCAAGAAATCCCGGTCCCGCCCCCCCAAGAG
AGCGACATCAACTATGATGAGCTCTACCCCAGTGCCTTCAACCAGCCGTCCTCGTACATACGGTTTTCTCAAACC
GTGGAGGAGTGCATCAGCTGCCAATATGACATGACAAGCGAGGACTATGACTTTCTCAAGTCGTACACGGACAGC
GGCCCCGCTGGGGGCCCCTTGTCCGAAGACGACTTCGAGCGCATCATGGAGGTCTTCGAGGACACGGCGGCGGAG
CAAACGCCCTATGCGTCGGTCGACAACACTGTCGTCGCCTATGACATGATGGTGCCCGCCCTGAACCACCTCGGT
TCTGCCTCCGTCCTCCAGCACGCAAAGGCGATCTATGAGTACTGGAGGACAAGGCGGCAGGGCATGGGCAACAAG
CCCCTGCACCCCTCGCTCAAGTTCGAGACGCATCAGGAGACGGACGACACCGACCCCTACGTTTGCTTCCGGCGG
CGCGAGGCGAGGCAAACGAGGAAGACGCGGGCGCGCGACAGCAAGATCGCAGAAACGCTCAAGCGTCTCCGGCGC
GAGCTCGAGGACGGTCGTCAACTCATCCTGATGACGTATGAGCGCGAGCTCATGAAGCGCGATCTCCTGCAGTCG
GACATGGCCGTCTTCGAAGGACGAGCCCGGTTGAAGCAGACGAAGATCAAGCTCGGCATCAAGGGCGAGGAGGAT
GACCTCGTAAACCAAAAGCCTCAGAAGCGCAAGGCGGCGGAGCCCCCGGCCGCGCAGAGGCCGTCGGGCACGCAG
CTCCGAGCCCCCGCACGCCCAGATGGACGATCGGTCGAGCAGGAGCTTGTGCTGCTCTCGGACCTGCTGACGCAA
AAGGAGAGGGAGCTTAGAGAGGAGATTGAGAGCAAGGTGCAGAATCACCGGAGATGGAATCAAAACCACATCGAT
CTTACCCGTGATCCACTTTCGCCCGTCAAGGAGCAGGGCATGGAGCTCAAGTTCCGGCCGGCCAAGACGCAGTAT
CTGATGACGCCGCCGGCATCGACGGCGTCCGAGTCGATGGACGTGGACGAAGAGGTGGCTGAGCCCATGGCCGTC
GACAGGCGGGAGTCGCCCGTCTTCCAGTTCAGAGCGGGCAGCGTGACGGGCGAGCAGGCGCATGCGCGTCAGCCG
TCGTTCCGCCGGCGCATCGGTCGTCTCCAGCGTCTGTGGATCGACCGGCGGGGCATGGCAAGCCCGCCGCGGGAG
ACGGACGAGTACTCGGACCGGTGGAAGTACGACTCGGACGACGACGACGTCGAGCCGCCGGTGTATGAGGTGGAC
CCGTTCGACACGCGTGCGCTCAAGTTCCGGGCGACGATCCCGCTCGGGCAGTCGATGTACCCACGAGGTCGGCCG
CAGATGGCTCCCGACGGCTCAAGCGGCGGGCCGGCGATGGGCAGAGTGCTGCCAGCACCGCCGACTGCGCAAGCC
ACGGCAGCGCAAGCGCAAGTCCATTCTCAGGCCCAGGCGGTCCAGGCTCAGGCTCAGGCTCAGGCTCAGGCTCAG
GCCCAGCTTCAGCTTCACCAAACCCAAGCACCGACGCAGATCCAGACCCAGGCCCAGACAGCCGCGTGA
Transcript >Hirsu2|459
ATGTCCTCCCGCAAGGTTCGAGTCAAGAAGTTGAGCGTCAAGACAACGCTGCCTGTCCTCCGAGAGGACCAGATC
GACCCTTCCGAATACGAGGCGCTCACCACCGACAACCTCATCGCCACCGGTGTCGAGCAGGCTGAGGAAAATGAA
TACCATCTGCAGACCATCCTCAAAGAGGCCGGGACCAGCAACGATCAAGAAATCCCGGTCCCGCCCCCCCAAGAG
AGCGACATCAACTATGATGAGCTCTACCCCAGTGCCTTCAACCAGCCGTCCTCGTACATACGGTTTTCTCAAACC
GTGGAGGAGTGCATCAGCTGCCAATATGACATGACAAGCGAGGACTATGACTTTCTCAAGTCGTACACGGACAGC
GGCCCCGCTGGGGGCCCCTTGTCCGAAGACGACTTCGAGCGCATCATGGAGGTCTTCGAGGACACGGCGGCGGAG
CAAACGCCCTATGCGTCGGTCGACAACACTGTCGTCGCCTATGACATGATGGTGCCCGCCCTGAACCACCTCGGT
TCTGCCTCCGTCCTCCAGCACGCAAAGGCGATCTATGAGTACTGGAGGACAAGGCGGCAGGGCATGGGCAACAAG
CCCCTGCACCCCTCGCTCAAGTTCGAGACGCATCAGGAGACGGACGACACCGACCCCTACGTTTGCTTCCGGCGG
CGCGAGGCGAGGCAAACGAGGAAGACGCGGGCGCGCGACAGCAAGATCGCAGAAACGCTCAAGCGTCTCCGGCGC
GAGCTCGAGGACGGTCGTCAACTCATCCTGATGACGTATGAGCGCGAGCTCATGAAGCGCGATCTCCTGCAGTCG
GACATGGCCGTCTTCGAAGGACGAGCCCGGTTGAAGCAGACGAAGATCAAGCTCGGCATCAAGGGCGAGGAGGAT
GACCTCGTAAACCAAAAGCCTCAGAAGCGCAAGGCGGCGGAGCCCCCGGCCGCGCAGAGGCCGTCGGGCACGCAG
CTCCGAGCCCCCGCACGCCCAGATGGACGATCGGTCGAGCAGGAGCTTGTGCTGCTCTCGGACCTGCTGACGCAA
AAGGAGAGGGAGCTTAGAGAGGAGATTGAGAGCAAGGTGCAGAATCACCGGAGATGGAATCAAAACCACATCGAT
CTTACCCGTGATCCACTTTCGCCCGTCAAGGAGCAGGGCATGGAGCTCAAGTTCCGGCCGGCCAAGACGCAGTAT
CTGATGACGCCGCCGGCATCGACGGCGTCCGAGTCGATGGACGTGGACGAAGAGGTGGCTGAGCCCATGGCCGTC
GACAGGCGGGAGTCGCCCGTCTTCCAGTTCAGAGCGGGCAGCGTGACGGGCGAGCAGGCGCATGCGCGTCAGCCG
TCGTTCCGCCGGCGCATCGGTCGTCTCCAGCGTCTGTGGATCGACCGGCGGGGCATGGCAAGCCCGCCGCGGGAG
ACGGACGAGTACTCGGACCGGTGGAAGTACGACTCGGACGACGACGACGTCGAGCCGCCGGTGTATGAGGTGGAC
CCGTTCGACACGCGTGCGCTCAAGTTCCGGGCGACGATCCCGCTCGGGCAGTCGATGTACCCACGAGGTCGGCCG
CAGATGGCTCCCGACGGCTCAAGCGGCGGGCCGGCGATGGGCAGAGTGCTGCCAGCACCGCCGACTGCGCAAGCC
ACGGCAGCGCAAGCGCAAGTCCATTCTCAGGCCCAGGCGGTCCAGGCTCAGGCTCAGGCTCAGGCTCAGGCTCAG
GCCCAGCTTCAGCTTCACCAAACCCAAGCACCGACGCAGATCCAGACCCAGGCCCAGACAGCCGCGTGA
Gene >Hirsu2|459
ATGTCCTCCCGCAAGGTTCGAGTCAAGAAGTTGAGCGTCAAGACAACGCTGCCTGTCCTCCGAGAGGACCAGATC
GACCCTTCCGAATACGAGGCGCTCACCACCGACAACCTCATCGCCACCGGTGTCGAGCAGGCTGAGGAAAATGTG
AGGCCTCCTGTTCCCTCCCCCTGGCTTCTGATATCACGTGCGCGGGCACGTGATATGACTCCCTCCCTTGGCCGC
TGATGGCGGCGCCCCCGGCGCCCCCCGAAGCCAAGGTCATATTCCCCGGCCTTCGGGATCGCCCCGACAACGACA
ACAAAAAAAAAAGACAGAGGTAGAGAGATAGGTCCCTCACTGACGACGTTGTCCGTATAGGAATACCATCTGCAG
ACCATCCTCAAAGAGGCCGGGACCAGCAACGATCAAGAAATCCCGGTCCCGCCCCCCCAAGAGAGCGACATCAAC
TATGATGAGCTCTACCCCAGTGCCTTCAACCAGCCGTCCTCGTACATACGGTTTTCTCAAACCGTGGAGGAGTGC
ATCAGCTGCCAATATGACATGACAAGCGAGGACTATGACTTTCTCAAGTCGTACACGGACAGCGGCCCCGCTGGG
GGCCCCTTGTCCGAAGACGACTTCGAGCGCATCATGGAGGTCTTCGAGGACACGGCGGCGGAGCAAACGCCCTAT
GCGTCGGTCGACAACACTGTCGTCGCCTATGACATGATGGTGCCCGCCCTGAACCACCTCGGTTCTGCCTCCGTC
CTCCAGCACGCAAAGGCGATCTATGAGTACTGGAGGACAAGGCGGCAGGGCATGGGCAACAAGCCCCTGCACCCC
TCGCTCAAGTTCGAGACGCATCAGGAGACGGACGACACCGACCCCTACGTTTGCTTCCGGCGGCGCGAGGCGAGG
CAAACGAGGAAGACGCGGGCGCGCGACAGCAAGATCGCAGAAACGCTCAAGCGTCTCCGGCGCGAGCTCGAGGAC
GGTCGTCAACTCATCCTGATGACGTATGAGCGCGAGCTCATGAAGCGCGATCTCCTGCAGTCGGACATGGCCGTC
TTCGAAGGACGAGCCCGGTTGAAGCAGACGAAGATCAAGCTCGGCATCAAGGGCGAGGAGGATGACCTCGTAAAC
CAAAAGGTACCCGCGACGCGGCCCCCTGCGCGTGTTAGCAAGCCAGTACTGACTAGAGTCCAGCCTCAGAAGCGC
AAGGCGGCGGAGCCCCCGGCCGCGCAGAGGCCGTCGGGCACGCAGCTCCGAGCCCCCGCACGCCCAGATGGACGA
TCGGTCGAGCAGGAGCTTGTGCTGCTCTCGGACCTGCTGACGCAAAAGGAGAGGGAGCTTAGAGAGGAGATTGAG
AGCAAGGTGCAGAATCACCGGAGATGGAATCAAAACCACATCGATCTTACCCGTGATCCACTTTCGCCCGTCAAG
GAGCAGGGCATGGAGCTCAAGTTCCGGCCGGCCAAGACGCAGTATCTGATGACGCCGCCGGCATCGACGGCGTCC
GAGTCGATGGACGTGGACGAAGAGGTGGCTGAGCCCATGGCCGTCGACAGGCGGGAGTCGCCCGTCTTCCAGTTC
AGAGCGGGCAGCGTGACGGGCGAGCAGGCGCATGCGCGTCAGCCGTCGTTCCGCCGGCGCATCGGTCGTCTCCAG
CGTCTGTGGATCGACCGGCGGGGCATGGCAAGCCCGCCGCGGGAGACGGACGAGTACTCGGACCGGTGGAAGTAC
GACTCGGACGACGACGACGTCGAGCCGCCGGTGTATGAGGTGGACCCGTTCGACACGCGTGCGCTCAAGTTCCGG
GCGACGATCCCGCTCGGGCAGTCGATGTACCCACGAGGTCGGCCGCAGATGGCTCCCGACGGCTCAAGCGGCGGG
CCGGCGATGGGCAGAGTGCTGCCAGCACCGCCGACTGCGCAAGCCACGGCAGCGCAAGCGCAAGTCCATTCTCAG
GCCCAGGCGGTCCAGGCTCAGGCTCAGGCTCAGGCTCAGGCTCAGGCCCAGCTTCAGCTTCACCAAACCCAAGCA
CCGACGCAGATCCAGACCCAGGCCCAGACAGCCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail