Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4589
Gene name
LocationContig_2324:228..1763
Strand-
Gene length (bp)1535
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain 5.0E-13 189 343

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42956|ART1_SCHPO Arrestin family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=art1 PE=3 SV=1 104 363 2.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4589
MASAPASVRVSGPPNSSFLVGYPGISATLPRIEGKVEIRPGQGYSMPVPVSLVRICLQRRETIHPDADSLTKRHL
GTPRRETTDVVGKEVLLFRCSTGKEAESVIAMDLPFVLFIPYGRGGEETNRRIPPASLQLPSRTAETYYEIVVTV
QQGHSNQYKYSFPMPLQRYDTLSTFGMYNKPETKLVSVDNIVHLGINLPRWSFGPNDPITVYLKLSPNLDWMSKA
KRVTIDKITLAIEEEITFNPEGDEPTKKVNKLSKQVQHVKMKLPEAGYATNIGLVFPCKDLRDPDGIVKRGKPAF
PLYEVSSFTTTSSLYKIEFYVSIKVQLGGARDVSLRQPVVICPLDQQGCKEEMDAIEQAAKDAALVDPTNPMLPA
RSIVLANDRDALRTLGLCMVGGQKKPFIXXXXXXXGGGGGANGDHNCGRQARGRGVMT*
Coding >Hirsu2|4589
ATGGCCTCTGCGCCGGCCAGCGTGAGGGTCTCGGGGCCCCCCAACAGCAGCTTCCTCGTCGGCTACCCGGGCATA
TCGGCCACCCTGCCGCGCATCGAGGGCAAGGTCGAGATCCGCCCCGGCCAGGGCTACTCCATGCCCGTGCCCGTC
TCCCTCGTCCGCATCTGCCTGCAGCGCCGCGAGACGATCCACCCCGACGCCGACAGCCTCACCAAGCGACATCTC
GGCACCCCGCGCCGCGAGACGACGGACGTGGTCGGCAAGGAGGTGCTGCTCTTCCGCTGCTCCACCGGCAAGGAG
GCCGAGAGCGTCATCGCCATGGACCTGCCCTTCGTCCTCTTCATCCCCTACGGCCGCGGCGGCGAGGAGACGAAC
CGACGCATCCCCCCCGCCTCGCTGCAGCTGCCCAGCCGCACGGCCGAGACGTACTACGAGATCGTCGTGACGGTG
CAGCAGGGCCACAGCAACCAGTACAAGTACAGCTTCCCCATGCCGCTGCAGCGCTACGACACCCTGTCCACCTTC
GGCATGTACAACAAGCCCGAGACCAAGCTCGTCTCCGTCGACAACATCGTCCACCTCGGCATCAACCTCCCCCGC
TGGAGCTTCGGCCCCAACGACCCCATCACCGTCTACCTCAAGCTGTCGCCCAACCTCGACTGGATGAGCAAGGCC
AAGCGCGTCACCATCGACAAGATCACCCTCGCCATCGAGGAGGAGATCACCTTCAACCCGGAGGGCGACGAGCCC
ACCAAAAAGGTCAACAAGCTGTCCAAGCAGGTCCAGCACGTCAAGATGAAGCTGCCCGAGGCCGGCTACGCCACC
AACATCGGCCTCGTCTTCCCCTGCAAGGACCTGCGCGACCCGGACGGCATCGTCAAGCGAGGCAAGCCCGCCTTC
CCCCTCTACGAGGTCTCATCCTTTACCACCACGTCGAGCCTCTACAAGATTGAGTTTTACGTCAGCATCAAGGTG
CAATTGGGCGGCGCTCGCGACGTCAGCCTACGCCAGCCCGTCGTCATCTGCCCCCTGGACCAGCAGGGCTGCAAA
GAGGAGATGGACGCCATCGAGCAAGCCGCCAAGGACGCGGCTCTCGTCGACCCGACCAACCCCATGCTCCCCGCC
CGCTCCATCGTCCTGGCCAACGACCGCGACGCCCTGCGCACACTCGGCCTCTGCATGGTGGGCGGCCAGAAGAAG
CCCTTCATCNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGGGGGGGCGAATGGGGATCACAACTGTGGGAGGCAG
GCTCGAGGCCGAGGTGTAATGACATGA
Transcript >Hirsu2|4589
ATGGCCTCTGCGCCGGCCAGCGTGAGGGTCTCGGGGCCCCCCAACAGCAGCTTCCTCGTCGGCTACCCGGGCATA
TCGGCCACCCTGCCGCGCATCGAGGGCAAGGTCGAGATCCGCCCCGGCCAGGGCTACTCCATGCCCGTGCCCGTC
TCCCTCGTCCGCATCTGCCTGCAGCGCCGCGAGACGATCCACCCCGACGCCGACAGCCTCACCAAGCGACATCTC
GGCACCCCGCGCCGCGAGACGACGGACGTGGTCGGCAAGGAGGTGCTGCTCTTCCGCTGCTCCACCGGCAAGGAG
GCCGAGAGCGTCATCGCCATGGACCTGCCCTTCGTCCTCTTCATCCCCTACGGCCGCGGCGGCGAGGAGACGAAC
CGACGCATCCCCCCCGCCTCGCTGCAGCTGCCCAGCCGCACGGCCGAGACGTACTACGAGATCGTCGTGACGGTG
CAGCAGGGCCACAGCAACCAGTACAAGTACAGCTTCCCCATGCCGCTGCAGCGCTACGACACCCTGTCCACCTTC
GGCATGTACAACAAGCCCGAGACCAAGCTCGTCTCCGTCGACAACATCGTCCACCTCGGCATCAACCTCCCCCGC
TGGAGCTTCGGCCCCAACGACCCCATCACCGTCTACCTCAAGCTGTCGCCCAACCTCGACTGGATGAGCAAGGCC
AAGCGCGTCACCATCGACAAGATCACCCTCGCCATCGAGGAGGAGATCACCTTCAACCCGGAGGGCGACGAGCCC
ACCAAAAAGGTCAACAAGCTGTCCAAGCAGGTCCAGCACGTCAAGATGAAGCTGCCCGAGGCCGGCTACGCCACC
AACATCGGCCTCGTCTTCCCCTGCAAGGACCTGCGCGACCCGGACGGCATCGTCAAGCGAGGCAAGCCCGCCTTC
CCCCTCTACGAGGTCTCATCCTTTACCACCACGTCGAGCCTCTACAAGATTGAGTTTTACGTCAGCATCAAGGTG
CAATTGGGCGGCGCTCGCGACGTCAGCCTACGCCAGCCCGTCGTCATCTGCCCCCTGGACCAGCAGGGCTGCAAA
GAGGAGATGGACGCCATCGAGCAAGCCGCCAAGGACGCGGCTCTCGTCGACCCGACCAACCCCATGCTCCCCGCC
CGCTCCATCGTCCTGGCCAACGACCGCGACGCCCTGCGCACACTCGGCCTCTGCATGGTGGGCGGCCAGAAGAAG
CCCTTCATCNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGGGGGGGCGAATGGGGATCACAACTGTGGGAGGCAG
GCTCGAGGCCGAGGTGTAATGACATGA
Gene >Hirsu2|4589
ATGGCCTCTGCGCCGGCCAGCGTGAGGGTCTCGGGGCCCCCCAACAGCAGCTTCCTCGTCGGCTACCCGGGCATA
TCGGCCACCCTGGTACGCTCTGCCCGCCCTCCCCCCTCGTCCTCTCGCCTCGTCTGCCTTCCGTCTTACCTCCCC
TTGCTGCCTGCCGCGGCCGGCCGTCCATGCTGACCCGAGGCCCCGTCCGCTCCCAGCCGCGCATCGAGGGCAAGG
TCGAGATCCGCCCCGGCCAGGGCTACTCCATGCCCGTGCCCGTCTCCCTCGTCCGCATCTGCCTGCAGCGCCGCG
AGACGATCCACCCCGACGCCGACAGCCTCACCAAGCGACATCTCGGCACCCCGCGCCGCGAGACGACGGACGTGG
TCGGCAAGGAGGTGCTGCTCTTCCGCTGCTCCACCGGCAAGGAGGCCGAGAGCGTCATCGCCATGGACCTGCCCT
TCGTCCTCTTCATCCCCTACGGCCGCGGCGGCGAGGAGACGAACCGACGCATCCCCCCCGCCTCGCTGCAGCTGC
CCAGCCGCACGGCCGAGACGTACTACGAGATCGTCGTGACGGTGCAGCAGGGCCACAGCAACCAGTACAAGTACA
GCTTCCCCATGCCGCTGCAGCGCTACGACACCCTGTCCACCTTCGGCATGTACAACAAGCCCGAGACCAAGCTCG
TCTCCGTCGACAACATCGTCCACCTCGGCATCAACCTCCCCCGCTGGAGCTTCGGCCCCAACGACCCCATCACCG
TCTACCTCAAGCTGTCGCCCAACCTCGACTGGATGAGCAAGGCCAAGCGCGTCACCATCGACAAGATCACCCTCG
CCATCGAGGAGGAGATCACCTTCAACCCGGAGGGCGACGAGCCCACCAAAAAGGTCAACAAGCTGTCCAAGCAGG
TCCAGCACGTCAAGATGAAGCTGCCCGAGGCCGGCTACGCCACCAACATCGGCCTCGTCTTCCCCTGCAAGGACC
TGCGCGACCCGGACGGCATCGTCAAGCGAGGCAAGCCCGCCTTCCCCCTCTACGAGGTCTCATCCTTTACCACCA
CGTCGAGCCTCTACAAGATTGAGTTTTACGTCAGCATCAAGGTATGTAGATTGGTCCGTCATCAAGGTCATTTCC
CCTTTTTCCGGGCTGGGATTGTCTGTTTCTTTGGTTGCCATCATCCATTGTCCACTCTGCTGACGATGCTGCTGC
GCCAGGTGCAATTGGGCGGCGCTCGCGACGTCAGCCTACGCCAGCCCGTCGTCATCTGCCCCCTGGACCAGCAGG
GCTGCAAAGAGGAGATGGACGCCATCGAGCAAGCCGCCAAGGACGCGGCTCTCGTCGACCCGACCAACCCCATGC
TCCCCGCCCGCTCCATCGTCCTGGCCAACGACCGCGACGCCCTGCGCACACTCGGCCTCTGCATGGTGGGCGGCC
AGAAGAAGCCCTTCATCNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGGGGGGGCGAATGGGGATCACAACTGTG
GGAGGCAGGCTCGAGGCCGAGGTGTAATGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail