Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|458
Gene name
LocationContig_1091:3423..4213
Strand-
Gene length (bp)790
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 2.4E-07 136 161
PF13499 EF-hand_7 EF-hand domain pair 3.1E-14 92 160
PF13405 EF-hand_6 EF-hand domain 4.7E-05 94 121
PF13202 EF-hand_5 EF hand 1.6E-04 26 48
PF13202 EF-hand_5 EF hand 1.8E-02 98 115
PF13202 EF-hand_5 EF hand 1.7E-06 137 160
PF13833 EF-hand_8 EF-hand domain pair 3.9E-04 70 115
PF13833 EF-hand_8 EF-hand domain pair 1.4E-04 140 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cnb-1 PE=2 SV=2 1 174 6.0E-120
sp|P0CM54|CANB_CRYNJ Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB1 PE=2 SV=1 1 172 9.0E-84
sp|P0CM55|CANB_CRYNB Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNB1 PE=3 SV=1 1 172 9.0E-84
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CNB1 PE=3 SV=1 1 171 7.0E-81
sp|Q9UU93|CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnb1 PE=3 SV=1 1 174 8.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cnb-1 PE=2 SV=2 1 174 6.0E-120
sp|P0CM54|CANB_CRYNJ Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB1 PE=2 SV=1 1 172 9.0E-84
sp|P0CM55|CANB_CRYNB Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNB1 PE=3 SV=1 1 172 9.0E-84
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CNB1 PE=3 SV=1 1 171 7.0E-81
sp|Q9UU93|CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnb1 PE=3 SV=1 1 174 8.0E-81
sp|Q6CGE6|CANB_YARLI Calcineurin subunit B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CNB1 PE=3 SV=1 9 174 1.0E-80
sp|Q874T7|CANB_KLULA Calcineurin subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CNB1 PE=3 SV=1 1 173 9.0E-79
sp|Q6BWS8|CANB_DEBHA Calcineurin subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CNB1 PE=3 SV=1 1 172 1.0E-78
sp|P25296|CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNB1 PE=1 SV=3 1 171 7.0E-78
sp|Q6FLU4|CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CNB1 PE=3 SV=1 1 171 1.0E-77
sp|P48451|CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster GN=CanB PE=2 SV=1 1 172 8.0E-69
sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus GN=Ppp3r1 PE=1 SV=2 1 172 2.0E-68
sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus GN=Ppp3r1 PE=1 SV=3 1 172 2.0E-68
sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens GN=PPP3R1 PE=1 SV=2 1 172 2.0E-68
sp|P63099|CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus GN=PPP3R1 PE=1 SV=2 1 172 2.0E-68
sp|P42322|CANB1_NAEGR Calcineurin subunit B OS=Naegleria gruberi GN=CNB1 PE=3 SV=1 1 171 2.0E-68
sp|Q24214|CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila melanogaster GN=CanB2 PE=1 SV=2 1 172 5.0E-68
sp|Q96LZ3|CANB2_HUMAN Calcineurin subunit B type 2 OS=Homo sapiens GN=PPP3R2 PE=1 SV=3 1 171 2.0E-61
sp|Q2TBI5|CANB2_BOVIN Calcineurin subunit B type 2 OS=Bos taurus GN=PPP3R2 PE=2 SV=3 1 170 5.0E-60
sp|P28470|CANB2_RAT Calcineurin subunit B type 2 OS=Rattus norvegicus GN=Ppp3r2 PE=2 SV=2 1 171 6.0E-60
sp|Q63811|CANB2_MOUSE Calcineurin subunit B type 2 OS=Mus musculus GN=Ppp3r2 PE=1 SV=3 1 171 4.0E-59
sp|Q55G87|CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum GN=cnbA PE=1 SV=1 1 164 1.0E-56
sp|Q54MF3|CANB2_DICDI Calcineurin subunit B type 2 OS=Dictyostelium discoideum GN=cnbB PE=3 SV=1 18 156 6.0E-37
sp|Q5R7F0|CHP1_PONAB Calcineurin B homologous protein 1 OS=Pongo abelii GN=CHP1 PE=2 SV=3 1 171 1.0E-35
sp|Q99653|CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens GN=CHP1 PE=1 SV=3 1 171 1.0E-35
sp|Q3SYS6|CHP1_BOVIN Calcineurin B homologous protein 1 OS=Bos taurus GN=CHP1 PE=2 SV=1 1 171 2.0E-35
sp|P61023|CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus GN=Chp1 PE=1 SV=2 1 171 2.0E-35
sp|P61022|CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus GN=Chp1 PE=1 SV=2 1 171 2.0E-35
sp|Q5ZM44|CHP1_CHICK Calcineurin B homologous protein 1 OS=Gallus gallus GN=CHP1 PE=1 SV=3 16 171 2.0E-34
sp|O43745|CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens GN=CHP2 PE=1 SV=3 1 171 1.0E-31
sp|Q9D869|CHP2_MOUSE Calcineurin B homologous protein 2 OS=Mus musculus GN=Chp2 PE=2 SV=4 1 171 6.0E-29
sp|Q810D1|CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus GN=Chp2 PE=1 SV=1 1 171 1.0E-28
sp|O75838|CIB2_HUMAN Calcium and integrin-binding family member 2 OS=Homo sapiens GN=CIB2 PE=1 SV=1 1 160 2.0E-23
sp|Q9Z309|CIB2_MOUSE Calcium and integrin-binding family member 2 OS=Mus musculus GN=Cib2 PE=1 SV=1 1 160 2.0E-22
sp|Q568Z7|CIB2_RAT Calcium and integrin-binding family member 2 OS=Rattus norvegicus GN=Cib2 PE=2 SV=1 1 160 4.0E-22
sp|Q5R6S5|HPCL4_PONAB Hippocalcin-like protein 4 OS=Pongo abelii GN=HPCAL4 PE=2 SV=3 1 171 3.0E-20
sp|Q9UM19|HPCL4_HUMAN Hippocalcin-like protein 4 OS=Homo sapiens GN=HPCAL4 PE=1 SV=3 1 171 3.0E-20
sp|P29104|HPCL4_BOVIN Hippocalcin-like protein 4 OS=Bos taurus GN=HPCAL4 PE=1 SV=3 1 171 3.0E-20
sp|C7A276|CIB2_SHEEP Calcium and integrin-binding family member 2 (Fragment) OS=Ovis aries GN=CIB2 PE=2 SV=1 18 160 1.0E-19
sp|Q8BGZ1|HPCL4_MOUSE Hippocalcin-like protein 4 OS=Mus musculus GN=Hpcal4 PE=1 SV=3 8 171 2.0E-19
sp|P42325|NCAH_DROME Neurocalcin homolog OS=Drosophila melanogaster GN=Nca PE=1 SV=2 8 156 3.0E-19
sp|P35332|HPCL4_RAT Hippocalcin-like protein 4 OS=Rattus norvegicus GN=Hpcal4 PE=2 SV=2 1 171 5.0E-19
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 21 160 9.0E-19
sp|P37236|FREQ_DROME Frequenin-1 OS=Drosophila melanogaster GN=Frq1 PE=2 SV=2 1 156 1.0E-18
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 20 160 1.0E-18
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 20 160 1.0E-18
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 20 160 2.0E-18
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 20 160 2.0E-18
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 20 164 2.0E-18
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 20 160 2.0E-18
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 21 160 2.0E-18
sp|A9JTH1|NCLDA_DANRE Neurocalcin-delta A OS=Danio rerio GN=ncalda PE=2 SV=1 8 167 2.0E-18
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 20 160 2.0E-18
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 20 160 2.0E-18
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 21 160 2.0E-18
sp|Q28IM6|HPCL1_XENTR Hippocalcin-like protein 1 OS=Xenopus tropicalis GN=hpcal1 PE=2 SV=1 8 158 3.0E-18
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 21 160 3.0E-18
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 21 160 3.0E-18
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 21 160 3.0E-18
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 21 160 3.0E-18
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 21 160 3.0E-18
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 21 160 3.0E-18
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 21 160 3.0E-18
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 21 160 3.0E-18
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 21 160 3.0E-18
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 21 160 3.0E-18
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 21 160 3.0E-18
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 21 160 3.0E-18
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 21 160 3.0E-18
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 21 160 3.0E-18
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 21 160 3.0E-18
sp|B5FZ84|HPCL1_TAEGU Hippocalcin-like protein 1 OS=Taeniopygia guttata GN=HPCAL1 PE=2 SV=1 8 158 3.0E-18
sp|P42324|HPCL1_CHICK Hippocalcin-like protein 1 OS=Gallus gallus GN=HPCAL1 PE=1 SV=2 8 158 3.0E-18
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 21 160 3.0E-18
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 21 160 3.0E-18
sp|Q5PQN0|NCALD_RAT Neurocalcin-delta OS=Rattus norvegicus GN=Ncald PE=1 SV=3 8 158 3.0E-18
sp|Q91X97|NCALD_MOUSE Neurocalcin-delta OS=Mus musculus GN=Ncald PE=1 SV=4 8 158 3.0E-18
sp|Q4R4N4|NCALD_MACFA Neurocalcin-delta OS=Macaca fascicularis GN=NCALD PE=2 SV=3 8 158 3.0E-18
sp|P61601|NCALD_HUMAN Neurocalcin-delta OS=Homo sapiens GN=NCALD PE=1 SV=2 8 158 3.0E-18
sp|P61602|NCALD_BOVIN Neurocalcin-delta OS=Bos taurus GN=NCALD PE=1 SV=2 8 158 3.0E-18
sp|Q6AXL4|NCLDB_DANRE Neurocalcin-delta B OS=Danio rerio GN=ncaldb PE=2 SV=1 1 162 3.0E-18
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 21 160 4.0E-18
sp|B3DLU1|NCALD_XENTR Neurocalcin-delta OS=Xenopus tropicalis GN=ncald PE=2 SV=1 8 158 4.0E-18
sp|Q6DCM9|HPCL1_XENLA Hippocalcin-like protein 1 OS=Xenopus laevis GN=hpcal1 PE=2 SV=1 8 158 4.0E-18
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 21 160 4.0E-18
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 21 160 5.0E-18
sp|Q7SY75|NCALD_XENLA Neurocalcin-delta OS=Xenopus laevis GN=ncald PE=2 SV=1 8 158 5.0E-18
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 21 160 5.0E-18
sp|P62759|NCALD_TAEGU Neurocalcin-delta OS=Taeniopygia guttata GN=NCALD PE=2 SV=2 8 158 5.0E-18
sp|P62758|NCALD_CHICK Neurocalcin-delta OS=Gallus gallus GN=NCALD PE=2 SV=2 8 158 5.0E-18
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 21 160 6.0E-18
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 21 160 6.0E-18
sp|B3VSB7|HPCL1_SHEEP Hippocalcin-like protein 1 OS=Ovis aries GN=HPCAL1 PE=2 SV=1 8 158 7.0E-18
sp|Q06AT0|HPCL1_PIG Hippocalcin-like protein 1 OS=Sus scrofa GN=HPCAL1 PE=2 SV=3 8 158 7.0E-18
sp|P29105|HPCL1_BOVIN Hippocalcin-like protein 1 OS=Bos taurus GN=HPCAL1 PE=1 SV=4 8 158 7.0E-18
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 21 162 7.0E-18
sp|Q5R632|HPCL1_PONAB Hippocalcin-like protein 1 OS=Pongo abelii GN=HPCAL1 PE=2 SV=3 8 158 9.0E-18
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 20 160 9.0E-18
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 21 160 9.0E-18
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 21 160 9.0E-18
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 20 160 9.0E-18
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 20 160 9.0E-18
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 20 160 9.0E-18
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 20 160 9.0E-18
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 21 160 1.0E-17
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 21 160 1.0E-17
sp|Q5RAH1|NCALD_PONAB Neurocalcin-delta OS=Pongo abelii GN=NCALD PE=2 SV=3 8 158 1.0E-17
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 21 160 1.0E-17
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 17 160 1.0E-17
sp|P37235|HPCL1_HUMAN Hippocalcin-like protein 1 OS=Homo sapiens GN=HPCAL1 PE=1 SV=3 8 158 1.0E-17
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 20 160 2.0E-17
sp|Q9C5P6|CNBL6_ARATH Calcineurin B-like protein 6 OS=Arabidopsis thaliana GN=CBL6 PE=1 SV=2 11 160 2.0E-17
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 21 160 2.0E-17
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 13 160 2.0E-17
sp|Q7FRS8|CNBLA_ARATH Calcineurin B-like protein 10 OS=Arabidopsis thaliana GN=CBL10 PE=1 SV=1 9 171 2.0E-17
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 20 160 2.0E-17
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 21 160 2.0E-17
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 21 160 2.0E-17
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 21 160 2.0E-17
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 21 160 2.0E-17
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 21 160 2.0E-17
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 21 160 2.0E-17
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 21 160 2.0E-17
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 21 160 2.0E-17
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 21 160 3.0E-17
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 21 156 3.0E-17
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 20 160 3.0E-17
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 20 160 3.0E-17
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 20 160 3.0E-17
sp|Q06389|NCS1_YEAST Calcium-binding protein NCS-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRQ1 PE=1 SV=2 1 156 3.0E-17
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 21 156 3.0E-17
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 21 160 4.0E-17
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 21 160 4.0E-17
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 20 160 4.0E-17
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 20 160 4.0E-17
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 20 160 4.0E-17
sp|Q3HRP0|CNBL7_ORYSJ Calcineurin B-like protein 7 OS=Oryza sativa subsp. japonica GN=CBL7 PE=2 SV=1 12 171 5.0E-17
sp|P62749|HPCL1_RAT Hippocalcin-like protein 1 OS=Rattus norvegicus GN=Hpcal1 PE=1 SV=2 8 158 5.0E-17
sp|P62748|HPCL1_MOUSE Hippocalcin-like protein 1 OS=Mus musculus GN=Hpcal1 PE=1 SV=2 8 158 5.0E-17
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 21 160 6.0E-17
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 21 160 6.0E-17
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 21 160 7.0E-17
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 21 160 7.0E-17
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 21 160 7.0E-17
sp|Q9FUQ7|CNBL8_ARATH Calcineurin B-like protein 8 OS=Arabidopsis thaliana GN=CBL8 PE=1 SV=1 16 171 7.0E-17
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 26 160 7.0E-17
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 21 160 7.0E-17
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 21 160 8.0E-17
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 26 156 9.0E-17
sp|Q16982|NECX_APLCA Neurocalcin OS=Aplysia californica PE=2 SV=2 8 156 1.0E-16
sp|Q75KU4|CNBL4_ORYSJ Calcineurin B-like protein 4 OS=Oryza sativa subsp. japonica GN=CBL4 PE=1 SV=1 2 167 1.0E-16
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 21 160 1.0E-16
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 21 160 1.0E-16
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 21 160 1.0E-16
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 17 160 2.0E-16
sp|P62762|VISL1_RAT Visinin-like protein 1 OS=Rattus norvegicus GN=Vsnl1 PE=1 SV=2 8 171 2.0E-16
sp|Q5RD22|VISL1_PONAB Visinin-like protein 1 OS=Pongo abelii GN=VSNL1 PE=2 SV=3 8 171 2.0E-16
sp|P62761|VISL1_MOUSE Visinin-like protein 1 OS=Mus musculus GN=Vsnl1 PE=1 SV=2 8 171 2.0E-16
sp|Q4R5F7|VISL1_MACFA Visinin-like protein 1 OS=Macaca fascicularis GN=VSNL1 PE=2 SV=3 8 171 2.0E-16
sp|P62760|VISL1_HUMAN Visinin-like protein 1 OS=Homo sapiens GN=VSNL1 PE=1 SV=2 8 171 2.0E-16
sp|P62764|VISL1_CHICK Visinin-like protein 1 OS=Gallus gallus GN=VSNL1 PE=2 SV=2 8 171 2.0E-16
sp|P62763|VISL1_BOVIN Visinin-like protein 1 OS=Bos taurus GN=VSNL1 PE=1 SV=2 8 171 2.0E-16
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 21 160 2.0E-16
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 21 160 2.0E-16
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 21 160 2.0E-16
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 21 160 2.0E-16
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 21 160 2.0E-16
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 21 160 2.0E-16
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 21 160 2.0E-16
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 21 160 2.0E-16
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 21 160 2.0E-16
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 21 160 2.0E-16
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 21 160 2.0E-16
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 21 160 2.0E-16
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 20 160 2.0E-16
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 21 160 2.0E-16
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 21 160 2.0E-16
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 17 160 3.0E-16
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 21 160 3.0E-16
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 21 160 3.0E-16
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 21 160 3.0E-16
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 21 160 3.0E-16
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 7 162 3.0E-16
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 20 160 3.0E-16
sp|Q86A72|Y4781_DICDI Recoverin family protein DDB_G0274781 OS=Dictyostelium discoideum GN=DDB_G0274781 PE=3 SV=1 8 160 3.0E-16
sp|Q96Q77|CIB3_HUMAN Calcium and integrin-binding family member 3 OS=Homo sapiens GN=CIB3 PE=1 SV=3 1 160 3.0E-16
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 13 160 4.0E-16
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 21 160 4.0E-16
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 21 160 4.0E-16
sp|Q9R010|CIB1_RAT Calcium and integrin-binding protein 1 OS=Rattus norvegicus GN=Cib1 PE=1 SV=3 20 163 6.0E-16
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 21 160 6.0E-16
sp|Q3HRP2|CNBL5_ORYSJ Calcineurin B-like protein 5 OS=Oryza sativa subsp. japonica GN=CBL5 PE=2 SV=1 16 171 6.0E-16
sp|Q9Z0F4|CIB1_MOUSE Calcium and integrin-binding protein 1 OS=Mus musculus GN=Cib1 PE=1 SV=3 20 163 7.0E-16
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 21 160 8.0E-16
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 20 160 8.0E-16
sp|B1A8Z2|CIB1_SHEEP Calcium and integrin-binding protein 1 OS=Ovis aries GN=CIB1 PE=2 SV=1 20 163 8.0E-16
sp|Q17QE5|CIB1_BOVIN Calcium and integrin-binding protein 1 OS=Bos taurus GN=CIB1 PE=2 SV=1 20 163 8.0E-16
sp|Q0P523|CIB3_MOUSE Calcium and integrin-binding family member 3 OS=Mus musculus GN=Cib3 PE=1 SV=1 26 160 9.0E-16
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 21 160 1.0E-15
sp|Q99828|CIB1_HUMAN Calcium and integrin-binding protein 1 OS=Homo sapiens GN=CIB1 PE=1 SV=4 20 163 1.0E-15
sp|Q3HRN8|CNBL9_ORYSJ Calcineurin B-like protein 9 OS=Oryza sativa subsp. japonica GN=CBL9 PE=2 SV=2 14 171 2.0E-15
sp|Q75K28|NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum GN=ncsA PE=1 SV=2 16 171 2.0E-15
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 16 163 3.0E-15
sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 1 156 3.0E-15
sp|Q09711|NCS1_SCHPO Calcium-binding protein NCS-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs1 PE=1 SV=2 1 158 3.0E-15
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 21 160 3.0E-15
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 1 156 3.0E-15
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 1 156 3.0E-15
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 1 156 3.0E-15
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 1 156 3.0E-15
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 21 160 3.0E-15
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 21 160 3.0E-15
sp|Q9Y2W7|CSEN_HUMAN Calsenilin OS=Homo sapiens GN=KCNIP3 PE=1 SV=1 9 168 4.0E-15
sp|Q3HRP5|CNBL2_ORYSJ Calcineurin B-like protein 2 OS=Oryza sativa subsp. japonica GN=CBL2 PE=2 SV=1 18 171 5.0E-15
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 21 160 6.0E-15
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 21 160 6.0E-15
sp|P49258|CALL_DROME Calmodulin-related protein 97A OS=Drosophila melanogaster GN=Acam PE=1 SV=2 16 160 6.0E-15
sp|Q3HRN9|CNBL8_ORYSJ Calcineurin B-like protein 8 OS=Oryza sativa subsp. japonica GN=CBL8 PE=2 SV=1 12 171 6.0E-15
sp|O73761|GUC1A_LITPI Guanylyl cyclase-activating protein 1 OS=Lithobates pipiens GN=GUCA1A PE=2 SV=3 22 169 6.0E-15
sp|Q8LAS7|CNBL2_ARATH Calcineurin B-like protein 2 OS=Arabidopsis thaliana GN=CBL2 PE=1 SV=2 18 171 7.0E-15
sp|Q3HRP1|CNBL6_ORYSJ Calcineurin B-like protein 6 OS=Oryza sativa subsp. japonica GN=CBL6 PE=2 SV=1 10 171 8.0E-15
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 21 160 8.0E-15
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 21 160 8.0E-15
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 21 160 8.0E-15
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 21 160 8.0E-15
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 21 160 8.0E-15
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 21 160 8.0E-15
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 21 160 8.0E-15
sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 1 156 9.0E-15
sp|Q75LU8|CNBL3_ORYSJ Calcineurin B-like protein 3 OS=Oryza sativa subsp. japonica GN=CBL3 PE=1 SV=1 18 171 9.0E-15
sp|P84076|HPCA_RAT Neuron-specific calcium-binding protein hippocalcin OS=Rattus norvegicus GN=Hpca PE=1 SV=2 8 158 1.0E-14
sp|Q06AT1|HPCA_PIG Neuron-specific calcium-binding protein hippocalcin OS=Sus scrofa GN=HPCA PE=2 SV=3 8 158 1.0E-14
sp|P84075|HPCA_MOUSE Neuron-specific calcium-binding protein hippocalcin OS=Mus musculus GN=Hpca PE=1 SV=2 8 158 1.0E-14
sp|P84074|HPCA_HUMAN Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens GN=HPCA PE=1 SV=2 8 158 1.0E-14
sp|Q4PL64|HPCA_BOVIN Neuron-specific calcium-binding protein hippocalcin OS=Bos taurus GN=HPCA PE=2 SV=3 8 158 1.0E-14
sp|Q9N1Q9|CABP2_BOVIN Calcium-binding protein 2 OS=Bos taurus GN=CABP2 PE=2 SV=3 1 160 1.0E-14
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 21 168 1.0E-14
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 26 160 1.0E-14
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 20 160 2.0E-14
sp|Q9JM47|CSEN_RAT Calsenilin OS=Rattus norvegicus GN=Kcnip3 PE=1 SV=1 9 168 2.0E-14
sp|Q8LEM7|CNBL3_ARATH Calcineurin B-like protein 3 OS=Arabidopsis thaliana GN=CBL3 PE=1 SV=2 18 171 3.0E-14
sp|O81223|CNBL4_ARATH Calcineurin B-like protein 4 OS=Arabidopsis thaliana GN=CBL4 PE=1 SV=3 16 171 3.0E-14
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 13 165 3.0E-14
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 39 160 3.0E-14
sp|Q17QD9|CSEN_BOVIN Calsenilin OS=Bos taurus GN=KCNIP3 PE=2 SV=1 9 168 3.0E-14
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 21 160 3.0E-14
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 39 160 3.0E-14
sp|P36608|NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans GN=ncs-1 PE=2 SV=2 2 156 4.0E-14
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 26 163 4.0E-14
sp|Q2V8Y7|NCS1_BOVIN Neuronal calcium sensor 1 OS=Bos taurus GN=NCS1 PE=1 SV=3 1 156 6.0E-14
sp|P79880|GUC1A_CHICK Guanylyl cyclase-activating protein 1 OS=Gallus gallus GN=GUCA1A PE=1 SV=3 22 165 6.0E-14
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 17 160 8.0E-14
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 9 156 8.0E-14
sp|Q502J0|PCAT2_DANRE Lysophosphatidylcholine acyltransferase 2 OS=Danio rerio GN=lpcat2 PE=2 SV=1 39 162 9.0E-14
sp|Q2KI69|KCIP4_BOVIN Kv channel-interacting protein 4 OS=Bos taurus GN=KCNIP4 PE=2 SV=1 16 156 1.0E-13
sp|Q9JM83|CALM4_MOUSE Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2 18 162 1.0E-13
sp|Q9LTB8|CNBL9_ARATH Calcineurin B-like protein 9 OS=Arabidopsis thaliana GN=CBL9 PE=1 SV=3 12 171 1.0E-13
sp|O81445|CNBL1_ARATH Calcineurin B-like protein 1 OS=Arabidopsis thaliana GN=CBL1 PE=1 SV=3 39 171 2.0E-13
sp|Q9NPB3|CABP2_HUMAN Calcium-binding protein 2 OS=Homo sapiens GN=CABP2 PE=1 SV=4 13 160 2.0E-13
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 17 160 3.0E-13
sp|Q3HRN7|CNBLA_ORYSJ Calcineurin B-like protein 10 OS=Oryza sativa subsp. japonica GN=CBL10 PE=2 SV=1 14 171 3.0E-13
sp|Q7XC27|CNBL1_ORYSJ Calcineurin B-like protein 1 OS=Oryza sativa subsp. japonica GN=CBL1 PE=2 SV=2 39 171 3.0E-13
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 26 163 3.0E-13
sp|Q99MG9|KCIP4_RAT Kv channel-interacting protein 4 OS=Rattus norvegicus GN=Kcnip4 PE=1 SV=1 16 171 3.0E-13
sp|Q6PHZ8|KCIP4_MOUSE Kv channel-interacting protein 4 OS=Mus musculus GN=Kcnip4 PE=1 SV=1 16 171 3.0E-13
sp|Q8HYN7|KCIP4_MACFA Kv channel-interacting protein 4 OS=Macaca fascicularis GN=KCNIP4 PE=2 SV=1 16 156 3.0E-13
sp|Q6PIL6|KCIP4_HUMAN Kv channel-interacting protein 4 OS=Homo sapiens GN=KCNIP4 PE=1 SV=1 16 156 3.0E-13
sp|Q9JLK4|CABP2_MOUSE Calcium-binding protein 2 OS=Mus musculus GN=Cabp2 PE=2 SV=3 13 160 3.0E-13
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 9 156 4.0E-13
sp|Q9NZI2|KCIP1_HUMAN Kv channel-interacting protein 1 OS=Homo sapiens GN=KCNIP1 PE=1 SV=2 9 164 5.0E-13
sp|A0PJX0|CIB4_HUMAN Calcium and integrin-binding family member 4 OS=Homo sapiens GN=CIB4 PE=1 SV=1 20 156 5.0E-13
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 27 163 5.0E-13
sp|Q3YLA4|NCS1_LYMST Neuronal calcium sensor 1 OS=Lymnaea stagnalis PE=2 SV=2 1 171 5.0E-13
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 23 162 5.0E-13
sp|Q9QXT8|CSEN_MOUSE Calsenilin OS=Mus musculus GN=Kcnip3 PE=1 SV=2 9 161 6.0E-13
sp|Q9D9N5|CIB4_MOUSE Calcium and integrin-binding family member 4 OS=Mus musculus GN=Cib4 PE=2 SV=1 20 156 6.0E-13
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 9 167 7.0E-13
sp|Q7FZF1|CNBL5_ARATH Calcineurin B-like protein 5 OS=Arabidopsis thaliana GN=CBL5 PE=1 SV=3 18 171 7.0E-13
sp|Q54LX0|CBPM_DICDI Calcium-binding protein M OS=Dictyostelium discoideum GN=cbpM PE=1 SV=1 5 156 8.0E-13
sp|P43081|GUC1A_MOUSE Guanylyl cyclase-activating protein 1 OS=Mus musculus GN=Guca1a PE=2 SV=3 9 161 8.0E-13
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 21 161 1.0E-12
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 13 171 1.0E-12
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 22 160 1.0E-12
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 13 160 1.0E-12
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 13 161 1.0E-12
sp|P46065|GUC1A_BOVIN Guanylyl cyclase-activating protein 1 OS=Bos taurus GN=GUCA1A PE=1 SV=2 9 161 2.0E-12
sp|Q8R426|KCIP1_RAT Kv channel-interacting protein 1 OS=Rattus norvegicus GN=Kcnip1 PE=1 SV=2 9 164 2.0E-12
sp|Q9JJ57|KCIP1_MOUSE Kv channel-interacting protein 1 OS=Mus musculus GN=Kcnip1 PE=1 SV=2 9 164 2.0E-12
sp|P43080|GUC1A_HUMAN Guanylyl cyclase-activating protein 1 OS=Homo sapiens GN=GUCA1A PE=1 SV=3 9 161 2.0E-12
sp|A0AVX7|CHP3_CHICK Calcineurin B homologous protein 3 OS=Gallus gallus GN=TESC PE=2 SV=1 1 171 2.0E-12
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 26 163 2.0E-12
sp|Q16981|NCS1_APLCA Neuronal calcium sensor 1 OS=Aplysia californica PE=2 SV=2 1 171 2.0E-12
sp|Q9NS61|KCIP2_HUMAN Kv channel-interacting protein 2 OS=Homo sapiens GN=KCNIP2 PE=1 SV=3 9 171 3.0E-12
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 13 160 3.0E-12
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 21 160 3.0E-12
sp|Q8WN03|KCIP2_MUSPF Kv channel-interacting protein 2 OS=Mustela putorius furo GN=Kcnip2 PE=2 SV=1 9 171 3.0E-12
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 21 165 4.0E-12
sp|C7A278|CIB4_SHEEP Calcium and integrin-binding family member 4 OS=Ovis aries GN=CIB4 PE=2 SV=1 20 156 4.0E-12
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 15 166 4.0E-12
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 21 165 4.0E-12
sp|Q3KQ77|EFCB1_XENLA EF-hand calcium-binding domain-containing protein 1 OS=Xenopus laevis GN=efcab1 PE=2 SV=1 17 165 5.0E-12
sp|P30187|CML10_ARATH Calmodulin-like protein 10 OS=Arabidopsis thaliana GN=CML10 PE=2 SV=1 15 160 6.0E-12
sp|Q7L5N7|PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens GN=LPCAT2 PE=1 SV=1 39 156 6.0E-12
sp|Q9JM59|KCIP2_RAT Kv channel-interacting protein 2 OS=Rattus norvegicus GN=Kcnip2 PE=1 SV=2 9 171 6.0E-12
sp|Q9N1Q8|CABP5_BOVIN Calcium-binding protein 5 OS=Bos taurus GN=CABP5 PE=1 SV=1 22 160 6.0E-12
sp|Q9JJ69|KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus GN=Kcnip2 PE=1 SV=2 9 171 7.0E-12
sp|Q9LF55|CML32_ARATH Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1 30 160 8.0E-12
sp|Q5ZCK5|CML16_ORYSJ Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1 22 160 8.0E-12
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 21 165 9.0E-12
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 60 156 1.0E-11
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 60 160 1.0E-11
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 21 165 1.0E-11
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 21 163 2.0E-11
sp|Q8BYI6|PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus GN=Lpcat2 PE=1 SV=1 39 156 2.0E-11
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 15 160 2.0E-11
sp|Q9NRD8|DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens GN=DUOX2 PE=1 SV=2 41 170 2.0E-11
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 26 163 2.0E-11
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 20 160 3.0E-11
sp|Q8HZK2|DUOX2_PIG Dual oxidase 2 OS=Sus scrofa GN=DUOX2 PE=1 SV=2 41 170 3.0E-11
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 26 165 3.0E-11
sp|P51177|GUC1B_BOVIN Guanylyl cyclase-activating protein 2 OS=Bos taurus GN=GUCA1B PE=1 SV=2 19 169 3.0E-11
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 26 165 3.0E-11
sp|P21457|RECO_BOVIN Recoverin OS=Bos taurus GN=RCVRN PE=1 SV=3 1 119 3.0E-11
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 60 160 3.0E-11
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 22 160 4.0E-11
sp|Q8MIH6|RECO_CANLF Recoverin OS=Canis lupus familiaris GN=RCVRN PE=3 SV=1 1 128 4.0E-11
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 13 164 4.0E-11
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 9 156 4.0E-11
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 9 156 5.0E-11
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 15 165 6.0E-11
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 20 162 6.0E-11
sp|P29289|TNNC1_HOMAM Troponin C, isoform 1 OS=Homarus americanus PE=1 SV=1 18 160 7.0E-11
sp|Q9JLK3|CABP5_MOUSE Calcium-binding protein 5 OS=Mus musculus GN=Cabp5 PE=1 SV=1 20 160 8.0E-11
sp|Q8HZK3|DUOX1_PIG Dual oxidase 1 OS=Sus scrofa GN=DUOX1 PE=2 SV=1 41 170 8.0E-11
sp|Q9ES45|DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus GN=Duox2 PE=2 SV=1 41 170 8.0E-11
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 13 160 9.0E-11
sp|Q1HAQ0|PCAT1_RAT Lysophosphatidylcholine acyltransferase 1 OS=Rattus norvegicus GN=Lpcat1 PE=2 SV=2 33 161 9.0E-11
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 26 165 9.0E-11
sp|Q9JLK7|CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus GN=Cabp1 PE=1 SV=3 21 160 1.0E-10
sp|Q5ZD81|CML12_ORYSJ Probable calcium-binding protein CML12 OS=Oryza sativa subsp. japonica GN=CML12 PE=2 SV=1 21 163 1.0E-10
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 13 164 1.0E-10
sp|P34057|RECO_MOUSE Recoverin OS=Mus musculus GN=Rcvrn PE=2 SV=2 1 137 1.0E-10
sp|Q9N1R0|CABP1_BOVIN Calcium-binding protein 1 OS=Bos taurus GN=CABP1 PE=1 SV=3 21 160 1.0E-10
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 16 163 1.0E-10
sp|P15159|TNNC_TACTR Troponin C OS=Tachypleus tridentatus PE=1 SV=1 15 160 1.0E-10
sp|Q9VQH2|DUOX_DROME Dual oxidase OS=Drosophila melanogaster GN=Duox PE=1 SV=2 40 161 1.0E-10
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 18 160 2.0E-10
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 15 173 2.0E-10
sp|Q3TFD2|PCAT1_MOUSE Lysophosphatidylcholine acyltransferase 1 OS=Mus musculus GN=Lpcat1 PE=1 SV=1 33 161 2.0E-10
sp|Q8CIY2|DUOX1_RAT Dual oxidase 1 OS=Rattus norvegicus GN=Duox1 PE=1 SV=1 41 170 2.0E-10
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 26 163 2.0E-10
sp|Q4V8A1|PCT2B_RAT Lysophosphatidylcholine acyltransferase 2B OS=Rattus norvegicus GN=Lpcat2b PE=2 SV=1 39 124 2.0E-10
sp|Q9MZF4|DUOX1_CANLF Dual oxidase 1 OS=Canis lupus familiaris GN=DUOX1 PE=1 SV=1 41 170 2.0E-10
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 16 163 2.0E-10
sp|Q96BS2|CHP3_HUMAN Calcineurin B homologous protein 3 OS=Homo sapiens GN=TESC PE=1 SV=3 16 171 2.0E-10
sp|P0C1Q3|PCAT2_RAT Lysophosphatidylcholine acyltransferase 2 OS=Rattus norvegicus GN=Lpcat2 PE=3 SV=1 60 156 2.0E-10
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 16 160 2.0E-10
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 17 160 2.0E-10
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 16 163 2.0E-10
sp|Q9SJN6|CML31_ARATH Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2 30 160 3.0E-10
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 20 161 3.0E-10
sp|Q3SEK2|CATR6_PARTE Caltractin ICL1f OS=Paramecium tetraurelia GN=Icl1f PE=3 SV=1 21 156 3.0E-10
sp|Q9S744|CML9_ARATH Calmodulin-like protein 9 OS=Arabidopsis thaliana GN=CML9 PE=1 SV=1 18 160 4.0E-10
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 6 161 4.0E-10
sp|Q94726|CATR4_PARTE Caltractin ICL1d OS=Paramecium tetraurelia GN=Icl1d PE=3 SV=1 21 156 4.0E-10
sp|Q27179|CATR2_PARTE Caltractin ICL1b OS=Paramecium tetraurelia GN=Icl1b PE=3 SV=2 21 156 4.0E-10
sp|P47948|TNNC2_DROME Troponin C, isoform 2 OS=Drosophila melanogaster GN=TpnC47D PE=2 SV=2 9 160 4.0E-10
sp|Q8NF37|PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens GN=LPCAT1 PE=1 SV=2 12 161 4.0E-10
sp|Q8VBV8|GUC1B_MOUSE Guanylyl cyclase-activating protein 2 OS=Mus musculus GN=Guca1b PE=2 SV=3 38 169 5.0E-10
sp|Q27178|CATR3_PARTE Caltractin ICL1c OS=Paramecium tetraurelia GN=Icl1c PE=3 SV=1 21 156 5.0E-10
sp|Q9JKL5|CHP3_MOUSE Calcineurin B homologous protein 3 OS=Mus musculus GN=Tesc PE=1 SV=2 16 171 5.0E-10
sp|Q9NP86|CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens GN=CABP5 PE=1 SV=1 20 160 5.0E-10
sp|Q27177|CATR1_PARTE Caltractin ICL1a OS=Paramecium tetraurelia GN=Icl1a PE=1 SV=2 21 156 7.0E-10
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 12 160 8.0E-10
sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 41 170 9.0E-10
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 26 165 9.0E-10
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 16 163 9.0E-10
sp|P36609|NCS2_CAEEL Neuronal calcium sensor 2 OS=Caenorhabditis elegans GN=ncs-2 PE=2 SV=2 9 156 1.0E-09
sp|O88751|CABP1_RAT Calcium-binding protein 1 OS=Rattus norvegicus GN=Cabp1 PE=1 SV=2 21 160 1.0E-09
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 12 161 1.0E-09
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 13 162 1.0E-09
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 24 162 1.0E-09
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 13 162 2.0E-09
sp|Q9D5U0|PCT2B_MOUSE Lysophosphatidylcholine acyltransferase 2B OS=Mus musculus GN=Lpcat2b PE=2 SV=1 44 124 2.0E-09
sp|O73763|GCIP_LITPI Guanylyl cyclase inhibitory protein OS=Lithobates pipiens GN=GCIP PE=2 SV=3 53 156 2.0E-09
sp|P31227|SMOD_LITCT S-modulin OS=Lithobates catesbeiana PE=1 SV=4 1 131 2.0E-09
sp|P22728|VISI_CHICK Visinin OS=Gallus gallus PE=2 SV=5 1 147 2.0E-09
sp|Q9M7R0|ALL8_OLEEU Calcium-binding allergen Ole e 8 OS=Olea europaea PE=1 SV=1 21 162 2.0E-09
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 13 160 2.0E-09
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 13 161 2.0E-09
sp|Q9SRP4|CML33_ARATH Probable calcium-binding protein CML33 OS=Arabidopsis thaliana GN=CML33 PE=2 SV=1 30 153 3.0E-09
sp|Q9UMX6|GUC1B_HUMAN Guanylyl cyclase-activating protein 2 OS=Homo sapiens GN=GUCA1B PE=1 SV=4 19 169 3.0E-09
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 13 162 3.0E-09
sp|P79881|GUC1B_CHICK Guanylyl cyclase-activating protein 2 OS=Gallus gallus GN=GUCA1B PE=2 SV=3 16 156 4.0E-09
sp|Q9NZU7|CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens GN=CABP1 PE=1 SV=5 21 160 4.0E-09
sp|P48593|E631_DROME Calcium-binding protein E63-1 OS=Drosophila melanogaster GN=Eip63F-1 PE=2 SV=2 13 160 5.0E-09
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 13 161 5.0E-09
sp|P35243|RECO_HUMAN Recoverin OS=Homo sapiens GN=RCVRN PE=1 SV=2 1 128 5.0E-09
sp|Q9ZQE6|CML1_ARATH Calmodulin-like protein 1 OS=Arabidopsis thaliana GN=CML1 PE=2 SV=1 18 165 5.0E-09
sp|P04109|SPE1A_STRPU Calcium-binding protein SPEC 1A OS=Strongylocentrotus purpuratus GN=SPEC1 PE=2 SV=3 18 163 6.0E-09
sp|P47949|TNNC3_DROME Troponin C, isoform 3 OS=Drosophila melanogaster GN=TpnC73F PE=2 SV=2 21 160 6.0E-09
sp|Q9LX27|CML4_ARATH Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1 26 166 6.0E-09
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 18 165 6.0E-09
sp|Q8AY75|CALGL_BOTIN Calglandulin OS=Bothrops insularis PE=2 SV=1 15 160 7.0E-09
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 21 162 7.0E-09
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 90 160 7.0E-09
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 13 163 8.0E-09
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 20 168 8.0E-09
sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 20 164 8.0E-09
sp|P57796|CABP4_HUMAN Calcium-binding protein 4 OS=Homo sapiens GN=CABP4 PE=1 SV=2 21 160 9.0E-09
sp|Q11083|YT67_CAEEL Uncharacterized calcium-binding protein B0563.7 OS=Caenorhabditis elegans GN=B0563.7 PE=3 SV=1 18 162 9.0E-09
sp|Q0DJV6|CML18_ORYSJ Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica GN=CML18 PE=2 SV=1 26 156 1.0E-08
sp|O73762|GUC1B_LITPI Guanylyl cyclase-activating protein 2 OS=Lithobates pipiens GN=GUCA1B PE=2 SV=3 38 156 1.0E-08
sp|Q9SU00|CML2_ARATH Calmodulin-like protein 2 OS=Arabidopsis thaliana GN=CML2 PE=2 SV=1 19 160 2.0E-08
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 13 162 2.0E-08
sp|Q3SB11|CALGL_TROCA Calglandulin OS=Tropidechis carinatus PE=2 SV=1 15 160 2.0E-08
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 22 160 2.0E-08
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 13 161 2.0E-08
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 18 160 2.0E-08
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 13 160 3.0E-08
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 24 160 3.0E-08
sp|Q8HZJ4|CABP4_BOVIN Calcium-binding protein 4 OS=Bos taurus GN=CABP4 PE=2 SV=1 21 160 3.0E-08
sp|Q9SUA6|CNBL7_ARATH Calcineurin B-like protein 7 OS=Arabidopsis thaliana GN=CBL7 PE=1 SV=1 57 160 3.0E-08
sp|P04110|SPE2A_STRPU Calcium-binding protein SPEC 2A OS=Strongylocentrotus purpuratus GN=SPEC2A PE=2 SV=2 18 163 4.0E-08
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 13 162 4.0E-08
sp|Q3SB13|CALGL_PSETE Calglandulin OS=Pseudonaja textilis PE=2 SV=1 15 160 4.0E-08
sp|Q3SB08|CALGL_PSEPO Calglandulin OS=Pseudechis porphyriacus PE=2 SV=1 15 160 4.0E-08
sp|Q3SB09|CALGL_PSEAU Calglandulin OS=Pseudechis australis PE=2 SV=1 15 160 4.0E-08
sp|Q3SB15|CALGL_OXYSC Calglandulin OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 15 160 4.0E-08
sp|Q3SB14|CALGL_OXYMI Calglandulin OS=Oxyuranus microlepidotus PE=2 SV=1 15 160 4.0E-08
sp|Q3SB12|CALGL_NOTSC Calglandulin OS=Notechis scutatus scutatus PE=2 SV=1 15 160 4.0E-08
sp|Q3SB10|CALGL_HOPST Calglandulin OS=Hoplocephalus stephensii PE=2 SV=1 15 160 4.0E-08
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 13 169 5.0E-08
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 13 167 5.0E-08
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 21 161 6.0E-08
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 21 165 7.0E-08
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 17 168 7.0E-08
sp|Q8VHC5|CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus GN=Cabp4 PE=1 SV=1 70 160 7.0E-08
sp|P21797|TNNC1_BALNU Troponin C, isoform 1 OS=Balanus nubilus PE=1 SV=1 16 160 7.0E-08
sp|Q86IV8|CBPKL_DICDI Calcium-binding protein K-like OS=Dictyostelium discoideum GN=DDB_G0274357 PE=3 SV=1 10 164 8.0E-08
sp|Q9SS31|CML36_ARATH Probable calcium-binding protein CML36 OS=Arabidopsis thaliana GN=CML36 PE=2 SV=1 30 161 1.0E-07
sp|O64943|POLC2_JUNOX Polcalcin Jun o 2 OS=Juniperus oxycedrus PE=1 SV=2 20 160 1.0E-07
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 16 156 2.0E-07
sp|Q0DJ94|CML21_ORYSJ Probable calcium-binding protein CML21 OS=Oryza sativa subsp. japonica GN=CML21 PE=2 SV=2 14 160 2.0E-07
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 13 160 2.0E-07
sp|P06707|TNNC1_ASTLP Troponin C, isotype alpha OS=Astacus leptodactylus PE=1 SV=1 17 120 2.0E-07
sp|Q6DN52|CBPL_DICDI Calcium-binding protein L OS=Dictyostelium discoideum GN=cbpL PE=2 SV=1 12 169 2.0E-07
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 15 165 3.0E-07
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 13 162 3.0E-07
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 52 156 3.0E-07
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 52 156 3.0E-07
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 13 165 4.0E-07
sp|P30188|CML35_ARATH Probable calcium-binding protein CML35 OS=Arabidopsis thaliana GN=CML35 PE=2 SV=2 26 160 4.0E-07
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 52 156 4.0E-07
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 52 156 4.0E-07
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 52 156 4.0E-07
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 13 161 4.0E-07
sp|Q9ZR02|CML6_ARATH Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1 26 161 5.0E-07
sp|P21798|TNNC2_BALNU Troponin C, isoform 2 OS=Balanus nubilus PE=1 SV=2 18 160 5.0E-07
sp|Q0DZP5|CML17_ORYSJ Probable calcium-binding protein CML17 OS=Oryza sativa subsp. japonica GN=CML17 PE=2 SV=1 26 160 5.0E-07
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 13 161 6.0E-07
sp|Q39584|DYL3_CHLRE Dynein 18 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 17 160 8.0E-07
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 52 156 1.0E-06
sp|Q8TD86|CALL6_HUMAN Calmodulin-like protein 6 OS=Homo sapiens GN=CALML6 PE=2 SV=2 21 160 1.0E-06
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 13 166 1.0E-06
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 13 157 1.0E-06
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 13 162 2.0E-06
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 26 160 2.0E-06
sp|Q9AWK2|CML11_ORYSJ Probable calcium-binding protein CML11 OS=Oryza sativa subsp. japonica GN=CML11 PE=2 SV=1 21 160 3.0E-06
sp|Q8VZ50|CML14_ARATH Probable calcium-binding protein CML14 OS=Arabidopsis thaliana GN=CML14 PE=2 SV=1 21 160 3.0E-06
sp|Q9SRP5|CML34_ARATH Probable calcium-binding protein CML34 OS=Arabidopsis thaliana GN=CML34 PE=1 SV=1 27 160 3.0E-06
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 21 156 3.0E-06
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 13 160 3.0E-06
sp|Q9CQ19|MYL9_MOUSE Myosin regulatory light polypeptide 9 OS=Mus musculus GN=Myl9 PE=1 SV=3 18 162 3.0E-06
sp|P21788|SP15_HEMPU 15 kDa calcium-binding protein OS=Hemicentrotus pulcherrimus PE=1 SV=1 30 163 3.0E-06
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 13 167 4.0E-06
sp|P24032|MLRN_CHICK Myosin regulatory light chain 2, smooth muscle minor isoform OS=Gallus gallus PE=2 SV=2 18 162 5.0E-06
sp|Q5RBA4|MYL9_PONAB Myosin regulatory light polypeptide 9 OS=Pongo abelii GN=MYL9 PE=2 SV=3 18 162 5.0E-06
sp|P29269|MYL9_PIG Myosin regulatory light polypeptide 9 OS=Sus scrofa GN=MYL9 PE=1 SV=2 18 162 5.0E-06
sp|P24844|MYL9_HUMAN Myosin regulatory light polypeptide 9 OS=Homo sapiens GN=MYL9 PE=1 SV=4 18 162 5.0E-06
sp|P02612|MLRM_CHICK Myosin regulatory light chain 2, smooth muscle major isoform OS=Gallus gallus PE=1 SV=2 18 162 7.0E-06
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 26 161 7.0E-06
sp|Q86JE1|Y2130_DICDI Recoverin family protein DDB_G0272130 OS=Dictyostelium discoideum GN=DDB_G0272130 PE=1 SV=1 1 163 7.0E-06
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 52 156 7.0E-06
sp|Q3V0K9|PLSI_MOUSE Plastin-1 OS=Mus musculus GN=Pls1 PE=1 SV=1 93 161 8.0E-06
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 16 160 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|458
MGNTTSAVLDNIVQGSNFDREEVDRLRKRFMKLDKDNSGTIERDEFLSLPQISSNPLATRMIAIFDEDGGGDVDF
QEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLKMMVGSNLKDQQLQQIVDKTIMEADLDKDGK
ISFEEFTKMVENTDVSMSMTLDQF*
Coding >Hirsu2|458
ATGGGCAACACCACCAGCGCGGTCCTGGACAACATCGTCCAAGGATCAAACTTCGACAGAGAAGAGGTCGATCGG
TTACGCAAGCGCTTCATGAAATTAGACAAGGACAACTCCGGCACCATCGAACGCGACGAGTTCCTCAGCCTACCA
CAAATCTCATCCAACCCTCTGGCCACACGAATGATTGCCATCTTCGACGAGGACGGTGGCGGCGACGTCGACTTC
CAAGAGTTCGTGTCAGGCCTGAGCGCATTCAGCAGCAAGGGCAACAAGGAGCAAAAGCTGCGGTTTGCCTTCAAG
GTCTACGACATCGACCGCGACGGCTACATCAGCAACGGCGAGCTCTTCATTGTCCTCAAGATGATGGTAGGGAGC
AACCTTAAGGACCAACAACTACAGCAGATTGTGGACAAGACGATCATGGAGGCCGACTTGGACAAGGACGGCAAG
ATCAGCTTCGAGGAGTTTACCAAGATGGTGGAGAATACGGACGTGAGCATGAGCATGACCCTTGATCAGTTTTGA
Transcript >Hirsu2|458
ATGGGCAACACCACCAGCGCGGTCCTGGACAACATCGTCCAAGGATCAAACTTCGACAGAGAAGAGGTCGATCGG
TTACGCAAGCGCTTCATGAAATTAGACAAGGACAACTCCGGCACCATCGAACGCGACGAGTTCCTCAGCCTACCA
CAAATCTCATCCAACCCTCTGGCCACACGAATGATTGCCATCTTCGACGAGGACGGTGGCGGCGACGTCGACTTC
CAAGAGTTCGTGTCAGGCCTGAGCGCATTCAGCAGCAAGGGCAACAAGGAGCAAAAGCTGCGGTTTGCCTTCAAG
GTCTACGACATCGACCGCGACGGCTACATCAGCAACGGCGAGCTCTTCATTGTCCTCAAGATGATGGTAGGGAGC
AACCTTAAGGACCAACAACTACAGCAGATTGTGGACAAGACGATCATGGAGGCCGACTTGGACAAGGACGGCAAG
ATCAGCTTCGAGGAGTTTACCAAGATGGTGGAGAATACGGACGTGAGCATGAGCATGACCCTTGATCAGTTTTGA
Gene >Hirsu2|458
ATGGGCAACACCACCAGCGCGGTCCTGGACAACATCGTCCAAGGATCAAACTGTGAGCAGCGAGGCGTCCACCGG
CGGTCGTGGTAGAGGCAGCGGCTGACGAGCTGCAGTCGACAGAGAAGAGGTCGATCGGTTACGCAAGCGCTTCAT
GAAATTAGACAAGGTGTGTGCGCCCTCGGTTCCGCTCGAGGCCGTGAATACTGCTCGCGCTTCATGCTGAACAGG
CTTTGTGTTTCCCAGGACAACTCCGGCACCATCGAACGCGACGAGTTCCTCAGCCTACCACAAATCTCATCCAAC
CCTCTGGCCACACGGTTCGCGCCCCCCCTTTCCCGGTCCACGTGCAGGCTGACATGGCTTCTTCCGCCGCAGAAT
GATTGCCATCTTCGACGAGGACGGTGGCGGCGACGTCGACTTCCAAGAGTTCGTGTCAGGCCTGAGCGCATTCAG
CAGCAAGGGCAACAAGGAGCAAAAGCTGCGGTTTGCCTTCAAGGTCTACGACATCGACCGCGACGGCTACATCAG
CAACGGCGAGCTCTTCATTGTCCTCAAGATGATGGTAGGGAGCAACCTTAAGGACCAACAACTACAGCAGATTGT
GGACAAGACGATCATGGAGGCCGACTTGGACAAGGACGGCAAGATCAGCTTCGAGGAGTTTACCAAGATGGTGGA
GAATACGGACGTGAGCATGAGCATGACCCTTGGTAGGTCTCNNCCCCCCCCCCCCCCCCTTTGTTCGCGGCCGTT
GAGAAGAGTAGCTAACGGCGCGCCCACAGATCAGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail