Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4576
Gene name
LocationContig_2318:1180..2248
Strand+
Gene length (bp)1068
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03059 NAS Nicotianamine synthase protein 8.2E-63 36 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2XFU4|NAS1_ORYSI Nicotianamine synthase 1 OS=Oryza sativa subsp. indica GN=NAS1 PE=2 SV=2 30 320 2.0E-33
sp|Q10MI9|NAS2_ORYSJ Nicotianamine synthase 2 OS=Oryza sativa subsp. japonica GN=NAS2 PE=2 SV=1 38 320 2.0E-33
sp|Q0DSH9|NAS1_ORYSJ Nicotianamine synthase 1 OS=Oryza sativa subsp. japonica GN=NAS1 PE=2 SV=1 30 320 2.0E-33
sp|Q9FKT9|NAS2_ARATH Nicotianamine synthase 2 OS=Arabidopsis thaliana GN=NAS2 PE=2 SV=1 38 320 9.0E-33
sp|Q0D3F2|NAS3_ORYSJ Nicotianamine synthase 3 OS=Oryza sativa subsp. japonica GN=NAS3 PE=2 SV=1 37 323 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2XFU4|NAS1_ORYSI Nicotianamine synthase 1 OS=Oryza sativa subsp. indica GN=NAS1 PE=2 SV=2 30 320 2.0E-33
sp|Q10MI9|NAS2_ORYSJ Nicotianamine synthase 2 OS=Oryza sativa subsp. japonica GN=NAS2 PE=2 SV=1 38 320 2.0E-33
sp|Q0DSH9|NAS1_ORYSJ Nicotianamine synthase 1 OS=Oryza sativa subsp. japonica GN=NAS1 PE=2 SV=1 30 320 2.0E-33
sp|Q9FKT9|NAS2_ARATH Nicotianamine synthase 2 OS=Arabidopsis thaliana GN=NAS2 PE=2 SV=1 38 320 9.0E-33
sp|Q0D3F2|NAS3_ORYSJ Nicotianamine synthase 3 OS=Oryza sativa subsp. japonica GN=NAS3 PE=2 SV=1 37 323 2.0E-32
sp|A2YQ58|NAS3_ORYSI Nicotianamine synthase 3 OS=Oryza sativa subsp. indica GN=NAS3 PE=2 SV=2 37 323 2.0E-32
sp|A2XFU5|NAS2_ORYSI Nicotianamine synthase 2 OS=Oryza sativa subsp. indica GN=NAS2 PE=2 SV=2 30 320 4.0E-32
sp|Q9XFB7|NAS9_HORVU Nicotianamine synthase 9 OS=Hordeum vulgare GN=NAS9 PE=1 SV=1 38 320 1.0E-30
sp|Q9XGI7|NAS_SOLLC Nicotianamine synthase OS=Solanum lycopersicum GN=CHLN PE=2 SV=1 38 328 5.0E-30
sp|Q9ZQV7|NAS2_HORVU Probable nicotianamine synthase 2 OS=Hordeum vulgare GN=NAS2 PE=2 SV=1 27 320 6.0E-30
sp|Q9FF79|NAS1_ARATH Nicotianamine synthase 1 OS=Arabidopsis thaliana GN=NAS1 PE=2 SV=1 27 328 7.0E-30
sp|Q9ZQV4|NAS5_HORVU Nicotianamine synthase-like 5 protein OS=Hordeum vulgare GN=NAS5 PE=1 SV=1 29 320 1.0E-29
sp|Q9ZQV9|NAS1_HORVU Nicotianamine synthase 1 OS=Hordeum vulgare GN=NAS1 PE=1 SV=3 38 320 3.0E-29
sp|Q9ZQV8|NAS3_HORVU Probable nicotianamine synthase 3 OS=Hordeum vulgare GN=NAS3 PE=2 SV=1 38 320 3.0E-28
sp|Q9C7X5|NAS4_ARATH Probable nicotianamine synthase 4 OS=Arabidopsis thaliana GN=NAS4 PE=2 SV=1 38 320 5.0E-28
sp|O80483|NAS3_ARATH Nicotianamine synthase 3 OS=Arabidopsis thaliana GN=NAS3 PE=2 SV=1 30 323 9.0E-27
sp|Q9XFB6|NAS8_HORVU Nicotianamine synthase 8 OS=Hordeum vulgare GN=NAS8 PE=1 SV=1 38 320 2.0E-26
sp|Q9ZQV6|NAS4_HORVU Probable nicotianamine synthase 4 OS=Hordeum vulgare GN=NAS4 PE=2 SV=1 38 320 5.0E-26
sp|Q9ZWH8|NAS7_HORVU Probable nicotianamine synthase 7 OS=Hordeum vulgare GN=NAS7 PE=2 SV=1 38 320 1.0E-25
sp|Q9ZQV3|NAS6_HORVU Probable nicotianamine synthase 6 OS=Hordeum vulgare GN=NAS6 PE=2 SV=1 38 320 5.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0030410 nicotianamine synthase activity Yes
GO:0030418 nicotianamine biosynthetic process Yes
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0042401 cellular biogenic amine biosynthetic process No
GO:0006576 cellular biogenic amine metabolic process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0017144 drug metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044106 cellular amine metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0009309 amine biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0009058 biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0072351 tricarboxylic acid biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0030417 nicotianamine metabolic process No
GO:0009308 amine metabolic process No
GO:0072350 tricarboxylic acid metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4576
MAGLSLLGQAHAIQRQGGAHDCVASPLAEKDQGVARNIIDHVLAIHAALRQQADLRPGRPVDELLTSLVERCVQI
HDTAVVQEVLADPGLRAALPSLQSMCARAECCLEAHWADAIAQGTDADDVYRLLRSFPYYDNYERLARLELCALC
SLGPMPTRVAFIGSGPLPLTSLCLLEALRGGGGGGVGAERRDDVGVLNIDRDEPAIAASRRLAAKLGHRARGTDF
VCAEAGSDAVDLAPFDVVYLAALVGASQAEKERLLIDVVRTMREGALAVVRTSWGLRTCLYSQFDVTTKAVLRWL
DVCLVLHPYGDIVNSVIVARVKPSPDKPRPVEA*
Coding >Hirsu2|4576
ATGGCCGGGCTTTCGCTGTTGGGCCAAGCCCATGCCATCCAGCGCCAAGGCGGCGCCCATGACTGTGTCGCCAGC
CCCCTGGCCGAGAAGGACCAGGGCGTGGCGCGCAACATCATCGACCACGTCCTCGCCATCCACGCCGCCCTGCGG
CAGCAGGCCGACCTCCGTCCCGGCCGGCCCGTCGACGAGCTGCTGACCAGCCTGGTCGAGCGCTGCGTCCAGATC
CACGACACGGCCGTCGTCCAAGAGGTCCTCGCCGACCCGGGCCTGCGAGCCGCCCTGCCGTCGCTGCAGAGCATG
TGCGCCCGGGCCGAGTGCTGCCTCGAGGCCCACTGGGCCGACGCCATCGCGCAGGGGACCGACGCCGACGACGTC
TACCGCCTGCTGCGGAGCTTCCCCTACTACGACAACTACGAGCGCCTGGCGCGCCTCGAGCTGTGCGCCCTCTGC
TCGCTCGGCCCGATGCCGACCCGCGTCGCCTTCATCGGCTCCGGGCCGCTGCCGCTGACGTCGCTGTGCCTGCTG
GAGGCGCTCAGGGGCGGCGGCGGCGGCGGCGTCGGGGCCGAGCGCCGCGACGACGTCGGCGTGCTCAACATCGAC
CGCGACGAGCCGGCCATCGCCGCCTCGCGCCGCCTCGCCGCCAAGCTCGGCCACCGCGCCCGCGGCACCGACTTC
GTCTGCGCCGAGGCCGGCTCCGACGCCGTCGACCTGGCGCCCTTTGACGTCGTCTACCTGGCCGCCCTGGTCGGC
GCCTCGCAGGCCGAGAAGGAGCGGCTGCTGATCGACGTCGTCCGCACGATGCGCGAGGGCGCCCTGGCCGTCGTC
CGCACCAGCTGGGGGCTGCGCACCTGTCTGTACTCCCAGTTCGACGTCACCACCAAGGCCGTCCTGCGCTGGCTC
GACGTCTGCCTCGTGCTGCACCCCTACGGCGACATCGTCAACTCCGTCATCGTCGCCAGGGTCAAGCCCAGCCCG
GACAAGCCGAGGCCGGTCGAGGCCTGA
Transcript >Hirsu2|4576
ATGGCCGGGCTTTCGCTGTTGGGCCAAGCCCATGCCATCCAGCGCCAAGGCGGCGCCCATGACTGTGTCGCCAGC
CCCCTGGCCGAGAAGGACCAGGGCGTGGCGCGCAACATCATCGACCACGTCCTCGCCATCCACGCCGCCCTGCGG
CAGCAGGCCGACCTCCGTCCCGGCCGGCCCGTCGACGAGCTGCTGACCAGCCTGGTCGAGCGCTGCGTCCAGATC
CACGACACGGCCGTCGTCCAAGAGGTCCTCGCCGACCCGGGCCTGCGAGCCGCCCTGCCGTCGCTGCAGAGCATG
TGCGCCCGGGCCGAGTGCTGCCTCGAGGCCCACTGGGCCGACGCCATCGCGCAGGGGACCGACGCCGACGACGTC
TACCGCCTGCTGCGGAGCTTCCCCTACTACGACAACTACGAGCGCCTGGCGCGCCTCGAGCTGTGCGCCCTCTGC
TCGCTCGGCCCGATGCCGACCCGCGTCGCCTTCATCGGCTCCGGGCCGCTGCCGCTGACGTCGCTGTGCCTGCTG
GAGGCGCTCAGGGGCGGCGGCGGCGGCGGCGTCGGGGCCGAGCGCCGCGACGACGTCGGCGTGCTCAACATCGAC
CGCGACGAGCCGGCCATCGCCGCCTCGCGCCGCCTCGCCGCCAAGCTCGGCCACCGCGCCCGCGGCACCGACTTC
GTCTGCGCCGAGGCCGGCTCCGACGCCGTCGACCTGGCGCCCTTTGACGTCGTCTACCTGGCCGCCCTGGTCGGC
GCCTCGCAGGCCGAGAAGGAGCGGCTGCTGATCGACGTCGTCCGCACGATGCGCGAGGGCGCCCTGGCCGTCGTC
CGCACCAGCTGGGGGCTGCGCACCTGTCTGTACTCCCAGTTCGACGTCACCACCAAGGCCGTCCTGCGCTGGCTC
GACGTCTGCCTCGTGCTGCACCCCTACGGCGACATCGTCAACTCCGTCATCGTCGCCAGGGTCAAGCCCAGCCCG
GACAAGCCGAGGCCGGTCGAGGCCTGA
Gene >Hirsu2|4576
ATGGCCGGGCTTTCGCTGTTGGGCCAAGCCCATGCCATCCAGCGCCAAGGCGGCGCCCATGACTGTGTCGCCAGC
CCCCTGGCCGAGAAGGACCAGGGCGTGGCGCGCAACATCATCGACCACGTCCTCGCCATCCACGCCGCCCTGCGG
CAGCAGGCCGACCTCCGTCCCGGCCGGCCCGTCGACGAGCTGCTGACCAGCCTGGTCGAGCGCTGCGTCCAGATC
CACGACACGGCCGTCGTCCAAGAGGTGAGTGAGCCGCTGCCGCCACTGCCGCTGCTGCTGCGCGTGGGTACTGAC
GAGCGAGACGGCCAGGTCCTCGCCGACCCGGGCCTGCGAGCCGCCCTGCCGTCGCTGCAGAGCATGTGCGCCCGG
GCCGAGTGCTGCCTCGAGGCCCACTGGGCCGACGCCATCGCGCAGGGGACCGACGCCGACGACGTCTACCGCCTG
CTGCGGAGCTTCCCCTACTACGACAACTACGAGCGCCTGGCGCGCCTCGAGCTGTGCGCCCTCTGCTCGCTCGGC
CCGATGCCGACCCGCGTCGCCTTCATCGGCTCCGGGCCGCTGCCGCTGACGTCGCTGTGCCTGCTGGAGGCGCTC
AGGGGCGGCGGCGGCGGCGGCGTCGGGGCCGAGCGCCGCGACGACGTCGGCGTGCTCAACATCGACCGCGACGAG
CCGGCCATCGCCGCCTCGCGCCGCCTCGCCGCCAAGCTCGGCCACCGCGCCCGCGGCACCGACTTCGTCTGCGCC
GAGGCCGGCTCCGACGCCGTCGACCTGGCGCCCTTTGACGTCGTCTACCTGGCCGCCCTGGTCGGCGCCTCGCAG
GCCGAGAAGGAGCGGCTGCTGATCGACGTCGTCCGCACGATGCGCGAGGGCGCCCTGGCCGTCGTCCGCACCAGC
TGGGGGCTGCGCACCTGTCTGTACTCCCAGTTCGACGTCACCACCAAGGCCGTCCTGCGCTGGCTCGACGTCTGC
CTCGTGCTGCACCCCTACGGCGACATCGTCAACTCCGTCATCGTCGCCAGGGTCAAGCCCAGCCCGGACAAGCCG
AGGCCGGTCGAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail