Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|456
Gene name
LocationContig_1091:5..926
Strand+
Gene length (bp)921
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04261 Dyp_perox Dyp-type peroxidase family 5.5E-72 13 297

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P76536|YFEX_ECOLI Probable deferrochelatase/peroxidase YfeX OS=Escherichia coli (strain K12) GN=yfeX PE=1 SV=2 23 303 4.0E-33

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0004601 peroxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016209 antioxidant activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6462 0.2279 0.0927 0.0786 0.2263 0.0054 0.1949 0.3003 0.2353 0.0111

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5267
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1750
Ophiocordyceps australis map64 (Brazil) OphauB2|7969
Ophiocordyceps camponoti-floridani Ophcf2|04813
Ophiocordyceps camponoti-rufipedis Ophun1|6193
Ophiocordyceps kimflemingae Ophio5|2276
Ophiocordyceps subramaniannii Hirsu2|456 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|456
LGGVGGLAKTVAVRDSSSSFSCTVGIGSDAWDRLVPTDGEGGRGRRPAELRPFRAVSGAAHTAPSTPGDLLFHIR
SDRRDVCFEFERLLMRRLGDAVAVEDLTVGFRYFDLRDLLGFVDGTANPVGPALPASVLVAAQDVGDAAVEQGQE
EGADDDEVRQESAAAVGGSYVVVQKYLHDLAAWEKLPAEAQEAIIGRTKLDNVELEDAAAGEQKSHKTLATIEDA
AGREHDILRDNMPFGSPGEGQFGTYFIGYSRRLWVIERMLRRMFVGDPPGLHDRILDYSTAATGAVFFVPSAALL
ASLGDD*
Coding >Hirsu2|456
CTGGGCGGCGTCGGCGGCCTGGCCAAGACGGTCGCGGTGCGCGACTCGAGCAGCTCCTTCTCCTGCACCGTCGGC
ATCGGCAGCGACGCCTGGGATCGGCTGGTTCCGACGGATGGTGAGGGCGGTCGCGGTCGCCGCCCGGCCGAGCTG
CGTCCGTTCCGCGCCGTCTCGGGCGCGGCCCACACGGCGCCGTCCACGCCCGGCGACCTGCTGTTCCACATCCGG
TCCGACCGGCGCGACGTCTGCTTCGAGTTCGAGCGGCTGCTGATGCGGCGGCTGGGCGACGCTGTGGCCGTCGAG
GACCTGACCGTCGGCTTCCGCTACTTCGACCTGCGCGACCTGCTGGGCTTCGTCGACGGCACCGCCAACCCCGTC
GGCCCGGCGCTGCCGGCTTCGGTCCTGGTCGCCGCGCAGGACGTCGGCGATGCGGCCGTCGAACAAGGACAAGAA
GAGGGCGCGGACGACGACGAGGTACGTCAGGAGTCGGCGGCGGCTGTGGGCGGCAGCTACGTCGTCGTGCAAAAG
TACCTGCACGACCTGGCCGCGTGGGAGAAGCTGCCGGCCGAGGCGCAGGAGGCCATCATCGGGCGCACCAAGCTG
GACAACGTCGAGCTCGAGGACGCGGCGGCCGGGGAGCAGAAGTCGCACAAGACGCTGGCGACGATCGAGGACGCG
GCCGGCCGCGAGCACGACATCCTGCGCGACAACATGCCCTTCGGCTCGCCCGGCGAGGGCCAGTTCGGCACCTAC
TTCATCGGCTACTCGCGCCGGCTCTGGGTCATCGAGCGCATGCTGCGCCGCATGTTCGTCGGCGACCCGCCCGGC
CTGCACGACCGCATCCTCGACTACTCGACCGCCGCCACCGGCGCCGTCTTCTTCGTCCCGTCCGCCGCTCTGCTA
GCCAGCCTCGGGGACGACTGA
Transcript >Hirsu2|456
CTGGGCGGCGTCGGCGGCCTGGCCAAGACGGTCGCGGTGCGCGACTCGAGCAGCTCCTTCTCCTGCACCGTCGGC
ATCGGCAGCGACGCCTGGGATCGGCTGGTTCCGACGGATGGTGAGGGCGGTCGCGGTCGCCGCCCGGCCGAGCTG
CGTCCGTTCCGCGCCGTCTCGGGCGCGGCCCACACGGCGCCGTCCACGCCCGGCGACCTGCTGTTCCACATCCGG
TCCGACCGGCGCGACGTCTGCTTCGAGTTCGAGCGGCTGCTGATGCGGCGGCTGGGCGACGCTGTGGCCGTCGAG
GACCTGACCGTCGGCTTCCGCTACTTCGACCTGCGCGACCTGCTGGGCTTCGTCGACGGCACCGCCAACCCCGTC
GGCCCGGCGCTGCCGGCTTCGGTCCTGGTCGCCGCGCAGGACGTCGGCGATGCGGCCGTCGAACAAGGACAAGAA
GAGGGCGCGGACGACGACGAGGTACGTCAGGAGTCGGCGGCGGCTGTGGGCGGCAGCTACGTCGTCGTGCAAAAG
TACCTGCACGACCTGGCCGCGTGGGAGAAGCTGCCGGCCGAGGCGCAGGAGGCCATCATCGGGCGCACCAAGCTG
GACAACGTCGAGCTCGAGGACGCGGCGGCCGGGGAGCAGAAGTCGCACAAGACGCTGGCGACGATCGAGGACGCG
GCCGGCCGCGAGCACGACATCCTGCGCGACAACATGCCCTTCGGCTCGCCCGGCGAGGGCCAGTTCGGCACCTAC
TTCATCGGCTACTCGCGCCGGCTCTGGGTCATCGAGCGCATGCTGCGCCGCATGTTCGTCGGCGACCCGCCCGGC
CTGCACGACCGCATCCTCGACTACTCGACCGCCGCCACCGGCGCCGTCTTCTTCGTCCCGTCCGCCGCTCTGCTA
GCCAGCCTCGGGGACGACTGA
Gene >Hirsu2|456
CTGGGCGGCGTCGGCGGCCTGGCCAAGACGGTCGCGGTGCGCGACTCGAGCAGCTCCTTCTCCTGCACCGTCGGC
ATCGGCAGCGACGCCTGGGATCGGCTGGTTCCGACGGATGGTGAGGGCGGTCGCGGTCGCCGCCCGGCCGAGCTG
CGTCCGTTCCGCGCCGTCTCGGGCGCGGCCCACACGGCGCCGTCCACGCCCGGCGACCTGCTGTTCCACATCCGG
TCCGACCGGCGCGACGTCTGCTTCGAGTTCGAGCGGCTGCTGATGCGGCGGCTGGGCGACGCTGTGGCCGTCGAG
GACCTGACCGTCGGCTTCCGCTACTTCGACCTGCGCGACCTGCTGGGCTTCGTCGACGGCACCGCCAACCCCGTC
GGCCCGGCGCTGCCGGCTTCGGTCCTGGTCGCCGCGCAGGACGTCGGCGATGCGGCCGTCGAACAAGGACAAGAA
GAGGGCGCGGACGACGACGAGGTACGTCAGGAGTCGGCGGCGGCTGTGGGCGGCAGCTACGTCGTCGTGCAAAAG
TACCTGCACGACCTGGCCGCGTGGGAGAAGCTGCCGGCCGAGGCGCAGGAGGCCATCATCGGGCGCACCAAGCTG
GACAACGTCGAGCTCGAGGACGCGGCGGCCGGGGAGCAGAAGTCGCACAAGACGCTGGCGACGATCGAGGACGCG
GCCGGCCGCGAGCACGACATCCTGCGCGACAACATGCCCTTCGGCTCGCCCGGCGAGGGCCAGTTCGGCACCTAC
TTCATCGGCTACTCGCGCCGGCTCTGGGTCATCGAGCGCATGCTGCGCCGCATGTTCGTCGGCGACCCGCCCGGC
CTGCACGACCGCATCCTCGACTACTCGACCGCCGCCACCGGCGCCGTCTTCTTCGTCCCGTCCGCCGCTCTGCTA
GCCAGCCTCGGGGACGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail