Protein ID | Hirsu2|4558 |
Gene name | |
Location | Contig_2308:432..2859 |
Strand | - |
Gene length (bp) | 2427 |
Transcript length (bp) | 1746 |
Coding sequence length (bp) | 1746 |
Protein length (aa) | 582 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF06418 | CTP_synth_N | CTP synthase N-terminus | 8.6E-123 | 3 | 271 |
PF00117 | GATase | Glutamine amidotransferase class-I | 1.1E-56 | 314 | 551 |
PF07722 | Peptidase_C26 | Peptidase C26 | 1.5E-06 | 392 | 534 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q7RZV2|PYRG_NEUCR | CTP synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-7 PE=3 SV=2 | 19 | 581 | 0.0E+00 |
sp|O74638|PYRG_GIBZE | CTP synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=URA7 PE=3 SV=2 | 2 | 581 | 0.0E+00 |
sp|P28274|URA7_YEAST | CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA7 PE=1 SV=2 | 2 | 560 | 0.0E+00 |
sp|Q6FUD0|PYRG_CANGA | CTP synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA7 PE=3 SV=1 | 2 | 560 | 0.0E+00 |
sp|Q751L7|PYRG_ASHGO | CTP synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA7 PE=3 SV=1 | 2 | 557 | 0.0E+00 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q7RZV2|PYRG_NEUCR | CTP synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-7 PE=3 SV=2 | 19 | 581 | 0.0E+00 |
sp|O74638|PYRG_GIBZE | CTP synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=URA7 PE=3 SV=2 | 2 | 581 | 0.0E+00 |
sp|P28274|URA7_YEAST | CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA7 PE=1 SV=2 | 2 | 560 | 0.0E+00 |
sp|Q6FUD0|PYRG_CANGA | CTP synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA7 PE=3 SV=1 | 2 | 560 | 0.0E+00 |
sp|Q751L7|PYRG_ASHGO | CTP synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA7 PE=3 SV=1 | 2 | 557 | 0.0E+00 |
sp|P38627|URA8_YEAST | CTP synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA8 PE=1 SV=4 | 2 | 569 | 0.0E+00 |
sp|A6ZQ59|URA8_YEAS7 | CTP synthase 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=URA8 PE=3 SV=1 | 2 | 569 | 0.0E+00 |
sp|O42644|PYRG_SCHPO | CTP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura7 PE=3 SV=1 | 2 | 562 | 0.0E+00 |
sp|Q6GME1|PYRG2_XENLA | CTP synthase 2 OS=Xenopus laevis GN=ctps2 PE=2 SV=1 | 2 | 564 | 0.0E+00 |
sp|Q7ZXP9|PYG1B_XENLA | CTP synthase 1-B OS=Xenopus laevis GN=ctps1-b PE=2 SV=1 | 2 | 559 | 0.0E+00 |
sp|Q5XHA8|PYG1A_XENLA | CTP synthase 1-A OS=Xenopus laevis GN=ctps1-a PE=2 SV=1 | 2 | 559 | 0.0E+00 |
sp|P70698|PYRG1_MOUSE | CTP synthase 1 OS=Mus musculus GN=Ctps1 PE=1 SV=2 | 2 | 557 | 0.0E+00 |
sp|P17812|PYRG1_HUMAN | CTP synthase 1 OS=Homo sapiens GN=CTPS1 PE=1 SV=2 | 2 | 557 | 0.0E+00 |
sp|Q6PEI7|PYRG1_DANRE | CTP synthase 1 OS=Danio rerio GN=ctps1 PE=1 SV=1 | 2 | 557 | 0.0E+00 |
sp|Q5F3Z1|PYRG2_CHICK | CTP synthase 2 OS=Gallus gallus GN=CTPS2 PE=2 SV=1 | 2 | 558 | 0.0E+00 |
sp|Q1RMS2|PYRG2_BOVIN | CTP synthase 2 OS=Bos taurus GN=CTPS2 PE=2 SV=1 | 2 | 558 | 0.0E+00 |
sp|Q9NRF8|PYRG2_HUMAN | CTP synthase 2 OS=Homo sapiens GN=CTPS2 PE=1 SV=1 | 2 | 558 | 0.0E+00 |
sp|Q5U2N0|PYRG2_RAT | CTP synthase 2 OS=Rattus norvegicus GN=Ctps2 PE=1 SV=1 | 2 | 558 | 0.0E+00 |
sp|P70303|PYRG2_MOUSE | CTP synthase 2 OS=Mus musculus GN=Ctps2 PE=1 SV=1 | 2 | 558 | 0.0E+00 |
sp|Q54V77|PYRG_DICDI | CTP synthase OS=Dictyostelium discoideum GN=ctps PE=3 SV=1 | 2 | 562 | 0.0E+00 |
sp|Q2M197|PYRG_DROPS | CTP synthase OS=Drosophila pseudoobscura pseudoobscura GN=CTPsyn PE=3 SV=2 | 2 | 560 | 0.0E+00 |
sp|Q9VUL1|PYRG_DROME | CTP synthase OS=Drosophila melanogaster GN=CTPsyn PE=1 SV=2 | 2 | 562 | 0.0E+00 |
sp|Q3IS15|PYRG_NATPD | CTP synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pyrG PE=3 SV=1 | 3 | 550 | 0.0E+00 |
sp|Q8TYT7|PYRG_METKA | CTP synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pyrG PE=3 SV=1 | 2 | 555 | 7.0E-180 |
sp|O29987|PYRG_ARCFU | CTP synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pyrG PE=3 SV=1 | 2 | 553 | 1.0E-179 |
sp|Q9HP32|PYRG_HALSA | CTP synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pyrG PE=3 SV=1 | 3 | 552 | 1.0E-177 |
sp|B0R6G2|PYRG_HALS3 | CTP synthase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pyrG PE=3 SV=1 | 3 | 552 | 1.0E-177 |
sp|Q18FG3|PYRG_HALWD | CTP synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pyrG PE=3 SV=1 | 3 | 558 | 2.0E-176 |
sp|Q3AFT7|PYRG_CARHZ | CTP synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-173 |
sp|Q5UX57|PYRG_HALMA | CTP synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pyrG PE=3 SV=1 | 3 | 555 | 2.0E-172 |
sp|Q12WH5|PYRG_METBU | CTP synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pyrG PE=3 SV=1 | 2 | 552 | 1.0E-171 |
sp|Q6L1K7|PYRG_PICTO | CTP synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pyrG PE=3 SV=1 | 2 | 553 | 2.0E-171 |
sp|P50547|PYRG1_CRIGR | CTP synthase 1 (Fragment) OS=Cricetulus griseus GN=CTPS1 PE=2 SV=1 | 41 | 492 | 2.0E-171 |
sp|A2SSJ7|PYRG_METLZ | CTP synthase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pyrG PE=3 SV=1 | 2 | 552 | 3.0E-171 |
sp|A0B7H6|PYRG_METTP | CTP synthase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pyrG PE=3 SV=1 | 2 | 552 | 4.0E-171 |
sp|A7IA93|PYRG_METB6 | CTP synthase OS=Methanoregula boonei (strain 6A8) GN=pyrG PE=3 SV=1 | 2 | 553 | 3.0E-169 |
sp|C5A7F1|PYRG_THEGJ | CTP synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-169 |
sp|Q6LYU4|PYRG_METMP | CTP synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=pyrG PE=3 SV=1 | 2 | 553 | 1.0E-168 |
sp|Q67TG8|PYRG_SYMTH | CTP synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-168 |
sp|B6YTF0|PYRG_THEON | CTP synthase OS=Thermococcus onnurineus (strain NA1) GN=pyrG PE=3 SV=1 | 1 | 553 | 8.0E-168 |
sp|Q8TZY6|PYRG_PYRFU | CTP synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pyrG PE=3 SV=2 | 1 | 553 | 4.0E-167 |
sp|A3CWS5|PYRG_METMJ | CTP synthase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pyrG PE=3 SV=1 | 2 | 553 | 5.0E-167 |
sp|Q1IKC9|PYRG_KORVE | CTP synthase OS=Koribacter versatilis (strain Ellin345) GN=pyrG PE=3 SV=1 | 3 | 553 | 6.0E-167 |
sp|Q1AW18|PYRG_RUBXD | CTP synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pyrG PE=3 SV=1 | 3 | 562 | 8.0E-167 |
sp|Q2FSE6|PYRG_METHJ | CTP synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pyrG PE=3 SV=1 | 2 | 553 | 9.0E-167 |
sp|B8GIB3|PYRG_METPE | CTP synthase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pyrG PE=3 SV=1 | 2 | 552 | 2.0E-166 |
sp|Q5JGF1|PYRG_THEKO | CTP synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-166 |
sp|Q2RFU8|PYRG_MOOTA | CTP synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=pyrG PE=3 SV=1 | 3 | 554 | 3.0E-166 |
sp|Q5N040|PYRG_SYNP6 | CTP synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=pyrG PE=3 SV=2 | 1 | 555 | 2.0E-165 |
sp|Q8DKT7|PYRG_THEEB | CTP synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=pyrG PE=3 SV=1 | 1 | 559 | 4.0E-165 |
sp|O59456|PYRG_PYRHO | CTP synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pyrG PE=3 SV=2 | 1 | 553 | 5.0E-165 |
sp|Q54775|PYRG_SYNE7 | CTP synthase OS=Synechococcus elongatus (strain PCC 7942) GN=pyrG PE=3 SV=1 | 1 | 555 | 5.0E-165 |
sp|B0CBC7|PYRG_ACAM1 | CTP synthase OS=Acaryochloris marina (strain MBIC 11017) GN=pyrG PE=3 SV=1 | 1 | 557 | 1.0E-164 |
sp|Q9RU23|PYRG_DEIRA | CTP synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pyrG PE=3 SV=1 | 2 | 553 | 1.0E-164 |
sp|B5Y8A3|PYRG_COPPD | CTP synthase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=pyrG PE=3 SV=1 | 3 | 555 | 3.0E-164 |
sp|Q1WV30|PYRG_LACS1 | CTP synthase OS=Lactobacillus salivarius (strain UCC118) GN=pyrG PE=3 SV=1 | 1 | 555 | 3.0E-164 |
sp|B9L7R9|PYRG_NAUPA | CTP synthase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=pyrG PE=3 SV=1 | 1 | 556 | 3.0E-164 |
sp|Q65DT7|PYRG_BACLD | CTP synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-164 |
sp|A6UTE4|PYRG_META3 | CTP synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pyrG PE=3 SV=1 | 2 | 559 | 2.0E-163 |
sp|A3DGR3|PYRG_CLOTH | CTP synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=pyrG PE=3 SV=1 | 2 | 553 | 3.0E-163 |
sp|Q8R720|PYRG_CALS4 | CTP synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pyrG PE=3 SV=1 | 1 | 552 | 3.0E-163 |
sp|B7JVR6|PYRG_CYAP8 | CTP synthase OS=Cyanothece sp. (strain PCC 8801) GN=pyrG PE=3 SV=1 | 1 | 553 | 8.0E-163 |
sp|Q8YMD4|PYRG_NOSS1 | CTP synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-162 |
sp|Q3MAV1|PYRG_ANAVT | CTP synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-162 |
sp|Q5SIA8|PYRG_THET8 | CTP synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pyrG PE=1 SV=1 | 3 | 559 | 1.0E-162 |
sp|C1F1E7|PYRG_ACIC5 | CTP synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-162 |
sp|Q9V1S2|PYRG_PYRAB | CTP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-162 |
sp|Q72IN0|PYRG_THET2 | CTP synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pyrG PE=3 SV=1 | 3 | 559 | 2.0E-162 |
sp|B9L1H7|PYRG_THERP | CTP synthase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=pyrG PE=3 SV=1 | 1 | 551 | 3.0E-162 |
sp|Q2JUH1|PYRG_SYNJA | CTP synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-162 |
sp|A5CYA0|PYRG_PELTS | CTP synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-162 |
sp|Q24MK9|PYRG_DESHY | CTP synthase OS=Desulfitobacterium hafniense (strain Y51) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-161 |
sp|Q58574|PYRG_METJA | CTP synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pyrG PE=3 SV=1 | 1 | 555 | 1.0E-161 |
sp|Q927T4|PYRG_LISIN | CTP synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-161 |
sp|Q8TKW5|PYRG_METAC | CTP synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pyrG PE=3 SV=1 | 2 | 552 | 2.0E-161 |
sp|Q71WM0|PYRG_LISMF | CTP synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-161 |
sp|B1XMC5|PYRG_SYNP2 | CTP synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=pyrG PE=3 SV=1 | 1 | 566 | 3.0E-161 |
sp|Q5KUG2|PYRG_GEOKA | CTP synthase OS=Geobacillus kaustophilus (strain HTA426) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-161 |
sp|A5UXX5|PYRG_ROSS1 | CTP synthase OS=Roseiflexus sp. (strain RS-1) GN=pyrG PE=3 SV=1 | 1 | 554 | 4.0E-161 |
sp|P13242|PYRG_BACSU | CTP synthase OS=Bacillus subtilis (strain 168) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-161 |
sp|B7KF08|PYRG_CYAP7 | CTP synthase OS=Cyanothece sp. (strain PCC 7424) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-161 |
sp|C1CWM4|PYRG_DEIDV | CTP synthase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=pyrG PE=3 SV=1 | 2 | 553 | 1.0E-160 |
sp|Q9HM27|PYRG_THEAC | CTP synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pyrG PE=3 SV=2 | 2 | 553 | 1.0E-160 |
sp|B9LB79|PYRG_CHLSY | CTP synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pyrG PE=3 SV=1 | 1 | 557 | 2.0E-160 |
sp|A9WJ75|PYRG_CHLAA | CTP synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pyrG PE=3 SV=1 | 1 | 557 | 2.0E-160 |
sp|Q8Y495|PYRG_LISMO | CTP synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-160 |
sp|A8FIE5|PYRG_BACP2 | CTP synthase OS=Bacillus pumilus (strain SAFR-032) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-160 |
sp|Q1J055|PYRG_DEIGD | CTP synthase OS=Deinococcus geothermalis (strain DSM 11300) GN=pyrG PE=3 SV=1 | 2 | 553 | 2.0E-160 |
sp|Q2LRK2|PYRG_SYNAS | CTP synthase OS=Syntrophus aciditrophicus (strain SB) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-160 |
sp|A7NN90|PYRG_ROSCS | CTP synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pyrG PE=3 SV=1 | 1 | 554 | 3.0E-160 |
sp|Q836G5|PYRG_ENTFA | CTP synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-160 |
sp|B1JBP2|PYRG_PSEPW | CTP synthase OS=Pseudomonas putida (strain W619) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-159 |
sp|B1WV74|PYRG_CYAA5 | CTP synthase OS=Cyanothece sp. (strain ATCC 51142) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-159 |
sp|Q8EM53|PYRG_OCEIH | CTP synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-159 |
sp|A6LQF6|PYRG_CLOB8 | CTP synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-159 |
sp|Q88MG1|PYRG_PSEPK | CTP synthase OS=Pseudomonas putida (strain KT2440) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-159 |
sp|A5W831|PYRG_PSEP1 | CTP synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-159 |
sp|B0KSB7|PYRG_PSEPG | CTP synthase OS=Pseudomonas putida (strain GB-1) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-159 |
sp|Q5WB43|PYRG_BACSK | CTP synthase OS=Bacillus clausii (strain KSM-K16) GN=pyrG PE=3 SV=1 | 3 | 545 | 6.0E-159 |
sp|Q97F61|PYRG_CLOAB | CTP synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyrG PE=3 SV=1 | 3 | 549 | 9.0E-159 |
sp|Q465Q4|PYRG_METBF | CTP synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pyrG PE=3 SV=1 | 2 | 564 | 1.0E-158 |
sp|Q8Q0L8|PYRG_METMA | CTP synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pyrG PE=3 SV=1 | 2 | 552 | 2.0E-158 |
sp|B8GAQ5|PYRG_CHLAD | CTP synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pyrG PE=3 SV=1 | 1 | 557 | 2.0E-158 |
sp|A7Z9T4|PYRG_BACMF | CTP synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-158 |
sp|Q1DDB7|PYRG_MYXXD | CTP synthase OS=Myxococcus xanthus (strain DK 1622) GN=pyrG PE=3 SV=1 | 3 | 558 | 3.0E-158 |
sp|Q1I644|PYRG_PSEE4 | CTP synthase OS=Pseudomonas entomophila (strain L48) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-158 |
sp|Q0AU97|PYRG_SYNWW | CTP synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=pyrG PE=3 SV=1 | 1 | 558 | 4.0E-158 |
sp|A7GV88|PYRG_BACCN | CTP synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-158 |
sp|A8FJJ0|PYRG_CAMJ8 | CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=pyrG PE=3 SV=1 | 3 | 553 | 6.0E-158 |
sp|Q9K6D7|PYRG_BACHD | CTP synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrG PE=3 SV=1 | 3 | 553 | 6.0E-158 |
sp|A7H1B7|PYRG_CAMJD | CTP synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=pyrG PE=3 SV=1 | 3 | 553 | 7.0E-158 |
sp|B8I598|PYRG_CLOCE | CTP synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pyrG PE=3 SV=1 | 2 | 553 | 9.0E-158 |
sp|A9VSD6|PYRG_BACWK | CTP synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-157 |
sp|C3K6H4|PYRG_PSEFS | CTP synthase OS=Pseudomonas fluorescens (strain SBW25) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-157 |
sp|A4VJT9|PYRG_PSEU5 | CTP synthase OS=Pseudomonas stutzeri (strain A1501) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-157 |
sp|Q980S6|PYRG_SULSO | CTP synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pyrG PE=1 SV=1 | 3 | 556 | 2.0E-157 |
sp|Q31G66|PYRG_THICR | CTP synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=pyrG PE=3 SV=1 | 1 | 554 | 2.0E-157 |
sp|Q5M6C0|PYRG_STRT2 | CTP synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-157 |
sp|Q81JW1|PYRG_BACAN | CTP synthase OS=Bacillus anthracis GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-157 |
sp|C3LFL2|PYRG_BACAC | CTP synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-157 |
sp|C3P2A0|PYRG_BACAA | CTP synthase OS=Bacillus anthracis (strain A0248) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-157 |
sp|Q0APT7|PYRG_MARMM | CTP synthase OS=Maricaulis maris (strain MCS10) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-157 |
sp|Q03T27|PYRG_LACBA | CTP synthase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pyrG PE=3 SV=1 | 1 | 554 | 3.0E-157 |
sp|C1DSS8|PYRG_AZOVD | CTP synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-157 |
sp|Q630R0|PYRG_BACCZ | CTP synthase OS=Bacillus cereus (strain ZK / E33L) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-157 |
sp|B7JHG1|PYRG_BACC0 | CTP synthase OS=Bacillus cereus (strain AH820) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-157 |
sp|Q8NZF8|PYRG_STRP8 | CTP synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-157 |
sp|Q1J4X1|PYRG_STRPF | CTP synthase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-157 |
sp|A3MXN2|PYRG_PYRCJ | CTP synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-157 |
sp|C0MFQ9|PYRG_STRS7 | CTP synthase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-157 |
sp|Q5M1S7|PYRG_STRT1 | CTP synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-157 |
sp|C0M8K6|PYRG_STRE4 | CTP synthase OS=Streptococcus equi subsp. equi (strain 4047) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|Q7NKF4|PYRG_GLOVI | CTP synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|A4XWS3|PYRG_PSEMY | CTP synthase OS=Pseudomonas mendocina (strain ymp) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|Q1JF16|PYRG_STRPD | CTP synthase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|B9IRX1|PYRG_BACCQ | CTP synthase OS=Bacillus cereus (strain Q1) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|B7HY98|PYRG_BACC7 | CTP synthase OS=Bacillus cereus (strain AH187) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|Q72XB0|PYRG_BACC1 | CTP synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|P0DD71|PYRG_STRPQ | CTP synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|Q1JK23|PYRG_STRPC | CTP synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|Q1J9X6|PYRG_STRPB | CTP synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|Q5XA10|PYRG_STRP6 | CTP synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|P0DD70|PYRG_STRP3 | CTP synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|P65925|PYRG_STRP1 | CTP synthase OS=Streptococcus pyogenes serotype M1 GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-156 |
sp|C4LBR2|PYRG_TOLAT | CTP synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pyrG PE=3 SV=1 | 3 | 559 | 2.0E-156 |
sp|Q6HAU5|PYRG_BACHK | CTP synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-156 |
sp|C1F0R6|PYRG_BACC3 | CTP synthase OS=Bacillus cereus (strain 03BB102) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-156 |
sp|A0RLC3|PYRG_BACAH | CTP synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-156 |
sp|B7IQZ1|PYRG_BACC2 | CTP synthase OS=Bacillus cereus (strain G9842) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-156 |
sp|Q814T2|PYRG_BACCR | CTP synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-156 |
sp|Q4ZWR0|PYRG_PSEU2 | CTP synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-156 |
sp|Q5HXD1|PYRG_CAMJR | CTP synthase OS=Campylobacter jejuni (strain RM1221) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-156 |
sp|A1VXA6|PYRG_CAMJJ | CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-156 |
sp|Q48RF1|PYRG_STRPM | CTP synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-156 |
sp|Q4KHF8|PYRG_PSEF5 | CTP synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-156 |
sp|Q886M5|PYRG_PSESM | CTP synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-156 |
sp|B7HFN6|PYRG_BACC4 | CTP synthase OS=Bacillus cereus (strain B4264) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-156 |
sp|Q97CR8|PYRG_THEVO | CTP synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pyrG PE=3 SV=1 | 2 | 553 | 8.0E-156 |
sp|B3R496|PYRG_CUPTR | CTP synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=pyrG PE=3 SV=1 | 1 | 559 | 9.0E-156 |
sp|Q48F77|PYRG_PSE14 | CTP synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-155 |
sp|Q0SQX5|PYRG_CLOPS | CTP synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-155 |
sp|Q8XIB3|PYRG_CLOPE | CTP synthase OS=Clostridium perfringens (strain 13 / Type A) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-155 |
sp|Q0TNA4|PYRG_CLOP1 | CTP synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-155 |
sp|P74208|PYRG_SYNY3 | CTP synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyrG PE=3 SV=1 | 1 | 570 | 2.0E-155 |
sp|Q9PJ84|PYRG_CAMJE | CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-155 |
sp|A4FKA9|PYRG_SACEN | CTP synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pyrG PE=3 SV=1 | 2 | 558 | 2.0E-155 |
sp|Q2SXC7|PYRG_BURTA | CTP synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pyrG PE=3 SV=1 | 1 | 556 | 2.0E-155 |
sp|A5GWT6|PYRG_SYNR3 | CTP synthase OS=Synechococcus sp. (strain RCC307) GN=pyrG PE=3 SV=1 | 1 | 567 | 2.0E-155 |
sp|Q3KH94|PYRG_PSEPF | CTP synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-155 |
sp|A0M3I8|PYRG_GRAFK | CTP synthase OS=Gramella forsetii (strain KT0803) GN=pyrG PE=3 SV=1 | 3 | 553 | 3.0E-155 |
sp|Q49Z73|PYRG_STAS1 | CTP synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pyrG PE=3 SV=1 | 1 | 558 | 4.0E-155 |
sp|Q8E290|PYRG_STRA5 | CTP synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-155 |
sp|Q63SP8|PYRG_BURPS | CTP synthase OS=Burkholderia pseudomallei (strain K96243) GN=pyrG PE=3 SV=1 | 1 | 556 | 4.0E-155 |
sp|Q3JQQ4|PYRG_BURP1 | CTP synthase OS=Burkholderia pseudomallei (strain 1710b) GN=pyrG PE=3 SV=1 | 1 | 556 | 4.0E-155 |
sp|A1V5K4|PYRG_BURMS | CTP synthase OS=Burkholderia mallei (strain SAVP1) GN=pyrG PE=3 SV=1 | 1 | 556 | 4.0E-155 |
sp|Q62J08|PYRG_BURMA | CTP synthase OS=Burkholderia mallei (strain ATCC 23344) GN=pyrG PE=3 SV=1 | 1 | 556 | 4.0E-155 |
sp|A3ML79|PYRG_BURM7 | CTP synthase OS=Burkholderia mallei (strain NCTC 10247) GN=pyrG PE=3 SV=1 | 1 | 556 | 4.0E-155 |
sp|A9B6S7|PYRG_HERA2 | CTP synthase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-155 |
sp|Q7V9I0|PYRG_PROMA | CTP synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-155 |
sp|B8HNM9|PYRG_CYAP4 | CTP synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-155 |
sp|Q2SKX2|PYRG_HAHCH | CTP synthase OS=Hahella chejuensis (strain KCTC 2396) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-155 |
sp|Q7NSG9|PYRG_CHRVO | CTP synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-155 |
sp|B4U6A9|PYRG_HYDS0 | CTP synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-155 |
sp|A3CQB0|PYRG_STRSV | CTP synthase OS=Streptococcus sanguinis (strain SK36) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-155 |
sp|Q9HXZ4|PYRG_PSEAE | CTP synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-155 |
sp|Q02RA9|PYRG_PSEAB | CTP synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-155 |
sp|B7V7V1|PYRG_PSEA8 | CTP synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-155 |
sp|A6V1F1|PYRG_PSEA7 | CTP synthase OS=Pseudomonas aeruginosa (strain PA7) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-155 |
sp|Q5WXA8|PYRG_LEGPL | CTP synthase OS=Legionella pneumophila (strain Lens) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-155 |
sp|Q38V48|PYRG_LACSS | CTP synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-155 |
sp|A9BDD9|PYRG_PROM4 | CTP synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=pyrG PE=3 SV=1 | 1 | 567 | 7.0E-155 |
sp|Q6A7X4|PYRG_PROAC | CTP synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pyrG PE=3 SV=1 | 3 | 538 | 8.0E-155 |
sp|Q8E7P8|PYRG_STRA3 | CTP synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pyrG PE=3 SV=1 | 1 | 553 | 9.0E-155 |
sp|Q3K3S2|PYRG_STRA1 | CTP synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pyrG PE=3 SV=1 | 1 | 553 | 9.0E-155 |
sp|Q1LPI8|PYRG_CUPMC | CTP synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pyrG PE=3 SV=1 | 1 | 553 | 9.0E-155 |
sp|A9IIP5|PYRG_BORPD | CTP synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-154 |
sp|A1S4D6|PYRG_SHEAM | CTP synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-154 |
sp|A2SAU5|PYRG_BURM9 | CTP synthase OS=Burkholderia mallei (strain NCTC 10229) GN=pyrG PE=3 SV=1 | 1 | 556 | 2.0E-154 |
sp|Q88Z76|PYRG_LACPL | CTP synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-154 |
sp|A5N3K4|PYRG_CLOK5 | CTP synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pyrG PE=3 SV=1 | 3 | 549 | 4.0E-154 |
sp|Q0A7K2|PYRG_ALKEH | CTP synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-154 |
sp|B0JU82|PYRG_MICAN | CTP synthase OS=Microcystis aeruginosa (strain NIES-843) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-154 |
sp|Q473G7|PYRG_CUPPJ | CTP synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pyrG PE=3 SV=1 | 1 | 559 | 6.0E-154 |
sp|Q8CNI2|PYRG_STAES | CTP synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-154 |
sp|Q5HM95|PYRG_STAEQ | CTP synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-154 |
sp|B2JIX2|PYRG_BURP8 | CTP synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-154 |
sp|Q2FWD1|PYRG_STAA8 | CTP synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=pyrG PE=3 SV=1 | 1 | 546 | 9.0E-154 |
sp|Q0KCE5|PYRG_CUPNH | CTP synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pyrG PE=3 SV=1 | 1 | 559 | 9.0E-154 |
sp|B8F5Q9|PYRG_HAEPS | CTP synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-153 |
sp|Q2JLG7|PYRG_SYNJB | CTP synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-153 |
sp|A6H0U1|PYRG_FLAPJ | CTP synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-153 |
sp|A8AZ08|PYRG_STRGC | CTP synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-153 |
sp|Q5ZWA4|PYRG_LEGPH | CTP synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-153 |
sp|A5IB79|PYRG_LEGPC | CTP synthase OS=Legionella pneumophila (strain Corby) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-153 |
sp|Q5X5Y6|PYRG_LEGPA | CTP synthase OS=Legionella pneumophila (strain Paris) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-153 |
sp|Q110M9|PYRG_TRIEI | CTP synthase OS=Trichodesmium erythraeum (strain IMS101) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-153 |
sp|Q8DWG1|PYRG_STRMU | CTP synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-153 |
sp|P65924|PYRG_STAAW | CTP synthase OS=Staphylococcus aureus (strain MW2) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|A8YY92|PYRG_STAAT | CTP synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|Q6G7I3|PYRG_STAAS | CTP synthase OS=Staphylococcus aureus (strain MSSA476) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|Q6GEU8|PYRG_STAAR | CTP synthase OS=Staphylococcus aureus (strain MRSA252) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|P99072|PYRG_STAAN | CTP synthase OS=Staphylococcus aureus (strain N315) GN=pyrG PE=1 SV=1 | 1 | 549 | 2.0E-153 |
sp|P65923|PYRG_STAAM | CTP synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|A6QIX1|PYRG_STAAE | CTP synthase OS=Staphylococcus aureus (strain Newman) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|Q5HE73|PYRG_STAAC | CTP synthase OS=Staphylococcus aureus (strain COL) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|Q2YUM6|PYRG_STAAB | CTP synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|A5IUS2|PYRG_STAA9 | CTP synthase OS=Staphylococcus aureus (strain JH9) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|Q2FF01|PYRG_STAA3 | CTP synthase OS=Staphylococcus aureus (strain USA300) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|A6U3L2|PYRG_STAA2 | CTP synthase OS=Staphylococcus aureus (strain JH1) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|A7X4X7|PYRG_STAA1 | CTP synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pyrG PE=3 SV=1 | 1 | 549 | 2.0E-153 |
sp|Q1QZX9|PYRG_CHRSD | CTP synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pyrG PE=3 SV=1 | 1 | 550 | 4.0E-153 |
sp|B0TK03|PYRG_SHEHH | CTP synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-153 |
sp|Q8ZSY7|PYRG_PYRAE | CTP synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-153 |
sp|A1VLH3|PYRG_POLNA | CTP synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=pyrG PE=3 SV=1 | 1 | 552 | 8.0E-153 |
sp|A3MYK8|PYRG_ACTP2 | CTP synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pyrG PE=3 SV=1 | 3 | 558 | 1.0E-152 |
sp|Q3A371|PYRG_PELCD | CTP synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-152 |
sp|B2RKS1|PYRG_PORG3 | CTP synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-152 |
sp|Q8Y0B8|PYRG_RALSO | CTP synthase OS=Ralstonia solanacearum (strain GMI1000) GN=pyrG PE=3 SV=1 | 1 | 565 | 1.0E-152 |
sp|Q7MWR7|PYRG_PORGI | CTP synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-152 |
sp|A8H1S4|PYRG_SHEPA | CTP synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pyrG PE=3 SV=1 | 3 | 563 | 2.0E-152 |
sp|A2C5F9|PYRG_PROM1 | CTP synthase OS=Prochlorococcus marinus (strain NATL1A) GN=pyrG PE=3 SV=1 | 1 | 580 | 2.0E-152 |
sp|A5UIK2|PYRG_HAEIG | CTP synthase OS=Haemophilus influenzae (strain PittGG) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-152 |
sp|B9MEQ7|PYRG_ACIET | CTP synthase OS=Acidovorax ebreus (strain TPSY) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-152 |
sp|A0KGH2|PYRG_AERHH | CTP synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-152 |
sp|Q11S24|PYRG_CYTH3 | CTP synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pyrG PE=3 SV=1 | 3 | 553 | 3.0E-152 |
sp|P44341|PYRG_HAEIN | CTP synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pyrG PE=3 SV=1 | 3 | 553 | 3.0E-152 |
sp|Q4FM39|PYRG_PELUB | CTP synthase OS=Pelagibacter ubique (strain HTCC1062) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-152 |
sp|A7HIF0|PYRG_ANADF | CTP synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pyrG PE=3 SV=1 | 3 | 553 | 3.0E-152 |
sp|O67353|PYRG_AQUAE | CTP synthase OS=Aquifex aeolicus (strain VF5) GN=pyrG PE=3 SV=1 | 1 | 558 | 4.0E-152 |
sp|Q12PZ5|PYRG_SHEDO | CTP synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pyrG PE=3 SV=1 | 3 | 560 | 4.0E-152 |
sp|Q74BY3|PYRG_GEOSL | CTP synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pyrG PE=3 SV=1 | 3 | 559 | 5.0E-152 |
sp|Q46I97|PYRG_PROMT | CTP synthase OS=Prochlorococcus marinus (strain NATL2A) GN=pyrG PE=3 SV=1 | 1 | 580 | 7.0E-152 |
sp|Q976E9|PYRG_SULTO | CTP synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pyrG PE=3 SV=2 | 1 | 556 | 7.0E-152 |
sp|Q97S93|PYRG_STRPN | CTP synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pyrG PE=3 SV=1 | 3 | 553 | 7.0E-152 |
sp|B0BS41|PYRG_ACTPJ | CTP synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pyrG PE=3 SV=1 | 3 | 558 | 8.0E-152 |
sp|B3GZX8|PYRG_ACTP7 | CTP synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pyrG PE=3 SV=1 | 3 | 558 | 8.0E-152 |
sp|B4EDA3|PYRG_BURCJ | CTP synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pyrG PE=3 SV=1 | 1 | 553 | 9.0E-152 |
sp|B1JUY8|PYRG_BURCC | CTP synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=pyrG PE=3 SV=1 | 1 | 553 | 9.0E-152 |
sp|A0K8N3|PYRG_BURCH | CTP synthase OS=Burkholderia cenocepacia (strain HI2424) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-151 |
sp|Q1BHS2|PYRG_BURCA | CTP synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-151 |
sp|Q8DQY0|PYRG_STRR6 | CTP synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-151 |
sp|A1TLT0|PYRG_ACIAC | CTP synthase OS=Acidovorax citrulli (strain AAC00-1) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-151 |
sp|Q086B1|PYRG_SHEFN | CTP synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-151 |
sp|B2U9C0|PYRG_RALPJ | CTP synthase OS=Ralstonia pickettii (strain 12J) GN=pyrG PE=3 SV=1 | 1 | 564 | 1.0E-151 |
sp|A5UD28|PYRG_HAEIE | CTP synthase OS=Haemophilus influenzae (strain PittEE) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-151 |
sp|Q604M6|PYRG_METCA | CTP synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-151 |
sp|Q15QR7|PYRG_PSEA6 | CTP synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pyrG PE=3 SV=1 | 1 | 554 | 2.0E-151 |
sp|Q6LMT0|PYRG_PHOPR | CTP synthase OS=Photobacterium profundum GN=pyrG PE=3 SV=1 | 4 | 557 | 2.0E-151 |
sp|C5CSV3|PYRG_VARPS | CTP synthase OS=Variovorax paradoxus (strain S110) GN=pyrG PE=3 SV=1 | 1 | 564 | 3.0E-151 |
sp|Q8EBQ9|PYRG_SHEON | CTP synthase OS=Shewanella oneidensis (strain MR-1) GN=pyrG PE=3 SV=1 | 3 | 559 | 3.0E-151 |
sp|Q4QLL2|PYRG_HAEI8 | CTP synthase OS=Haemophilus influenzae (strain 86-028NP) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-151 |
sp|A1W4R3|PYRG_ACISJ | CTP synthase OS=Acidovorax sp. (strain JS42) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-151 |
sp|B8IZF5|PYRG_DESDA | CTP synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pyrG PE=3 SV=1 | 3 | 553 | 6.0E-151 |
sp|A4JFY7|PYRG_BURVG | CTP synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pyrG PE=3 SV=1 | 1 | 553 | 6.0E-151 |
sp|B2SXV1|PYRG_BURPP | CTP synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-151 |
sp|Q13X05|PYRG_BURXL | CTP synthase OS=Burkholderia xenovorans (strain LB400) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-151 |
sp|Q65VZ8|PYRG_MANSM | CTP synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pyrG PE=3 SV=2 | 3 | 553 | 8.0E-151 |
sp|Q73HS5|PYRG_WOLPM | CTP synthase OS=Wolbachia pipientis wMel GN=pyrG PE=3 SV=1 | 3 | 553 | 8.0E-151 |
sp|Q7UJ86|PYRG_RHOBA | CTP synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pyrG PE=3 SV=1 | 1 | 553 | 9.0E-151 |
sp|Q7VGH1|PYRG_HELHP | CTP synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=pyrG PE=3 SV=1 | 2 | 550 | 9.0E-151 |
sp|A5FHA4|PYRG_FLAJ1 | CTP synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pyrG PE=3 SV=1 | 3 | 556 | 9.0E-151 |
sp|A1TZ46|PYRG_MARHV | CTP synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-150 |
sp|B1YT11|PYRG_BURA4 | CTP synthase OS=Burkholderia ambifaria (strain MC40-6) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-150 |
sp|Q5GTB4|PYRG_WOLTR | CTP synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=pyrG PE=3 SV=1 | 3 | 552 | 1.0E-150 |
sp|Q7V3W8|PYRG_PROMM | CTP synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-150 |
sp|B8DJR8|PYRG_DESVM | CTP synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-150 |
sp|Q0HXH1|PYRG_SHESR | CTP synthase OS=Shewanella sp. (strain MR-7) GN=pyrG PE=3 SV=1 | 3 | 559 | 1.0E-150 |
sp|Q2IH81|PYRG_ANADE | CTP synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-150 |
sp|Q0BDS1|PYRG_BURCM | CTP synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-150 |
sp|B8JBN6|PYRG_ANAD2 | CTP synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-150 |
sp|B4UIT6|PYRG_ANASK | CTP synthase OS=Anaeromyxobacter sp. (strain K) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-150 |
sp|Q7VNV5|PYRG_HAEDU | CTP synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pyrG PE=3 SV=1 | 3 | 558 | 2.0E-150 |
sp|B8E8T0|PYRG_SHEB2 | CTP synthase OS=Shewanella baltica (strain OS223) GN=pyrG PE=3 SV=1 | 3 | 559 | 3.0E-150 |
sp|A9KYH1|PYRG_SHEB9 | CTP synthase OS=Shewanella baltica (strain OS195) GN=pyrG PE=3 SV=1 | 3 | 559 | 3.0E-150 |
sp|A6WR29|PYRG_SHEB8 | CTP synthase OS=Shewanella baltica (strain OS185) GN=pyrG PE=3 SV=1 | 3 | 559 | 3.0E-150 |
sp|A3D796|PYRG_SHEB5 | CTP synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pyrG PE=3 SV=1 | 3 | 559 | 3.0E-150 |
sp|A2CDX8|PYRG_PROM3 | CTP synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-150 |
sp|A1RHF2|PYRG_SHESW | CTP synthase OS=Shewanella sp. (strain W3-18-1) GN=pyrG PE=3 SV=1 | 3 | 559 | 3.0E-150 |
sp|A4Y944|PYRG_SHEPC | CTP synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pyrG PE=3 SV=1 | 3 | 559 | 3.0E-150 |
sp|Q2J878|PYRG_FRASC | CTP synthase OS=Frankia sp. (strain CcI3) GN=pyrG PE=3 SV=1 | 1 | 559 | 4.0E-150 |
sp|Q9CJW9|PYRG_PASMU | CTP synthase OS=Pasteurella multocida (strain Pm70) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-150 |
sp|Q7VW76|PYRG_BORPE | CTP synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-150 |
sp|Q7W5N6|PYRG_BORPA | CTP synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-150 |
sp|Q7WD72|PYRG_BORBR | CTP synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-150 |
sp|Q9Z8U8|PYRG_CHLPN | CTP synthase OS=Chlamydia pneumoniae GN=pyrG PE=3 SV=2 | 2 | 553 | 4.0E-150 |
sp|Q39W62|PYRG_GEOMG | CTP synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-150 |
sp|A1SSQ6|PYRG_PSYIN | CTP synthase OS=Psychromonas ingrahamii (strain 37) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-150 |
sp|Q5FME6|PYRG_LACAC | CTP synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pyrG PE=3 SV=1 | 1 | 555 | 6.0E-150 |
sp|Q47QN2|PYRG_THEFY | CTP synthase OS=Thermobifida fusca (strain YX) GN=pyrG PE=3 SV=2 | 3 | 553 | 6.0E-150 |
sp|Q0VQD8|PYRG_ALCBS | CTP synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-150 |
sp|A3QC76|PYRG_SHELP | CTP synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pyrG PE=3 SV=1 | 3 | 559 | 7.0E-150 |
sp|A8YXF8|PYRG_LACH4 | CTP synthase OS=Lactobacillus helveticus (strain DPC 4571) GN=pyrG PE=3 SV=1 | 1 | 555 | 7.0E-150 |
sp|B4SAT4|PYRG_PELPB | CTP synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=pyrG PE=3 SV=1 | 2 | 553 | 7.0E-150 |
sp|B9DME0|PYRG_STACT | CTP synthase OS=Staphylococcus carnosus (strain TM300) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-150 |
sp|A1WWZ4|PYRG_HALHL | CTP synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pyrG PE=3 SV=1 | 1 | 558 | 8.0E-150 |
sp|Q8AA75|PYRG_BACTN | CTP synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pyrG PE=3 SV=1 | 3 | 553 | 9.0E-150 |
sp|A8FSS7|PYRG_SHESH | CTP synthase OS=Shewanella sediminis (strain HAW-EB3) GN=pyrG PE=3 SV=1 | 3 | 559 | 1.0E-149 |
sp|Q0HL73|PYRG_SHESM | CTP synthase OS=Shewanella sp. (strain MR-4) GN=pyrG PE=3 SV=1 | 3 | 559 | 1.0E-149 |
sp|Q2RT58|PYRG_RHORT | CTP synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-149 |
sp|A9BN39|PYRG_DELAS | CTP synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-149 |
sp|Q4L808|PYRG_STAHJ | CTP synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-149 |
sp|B2IUT0|PYRG_NOSP7 | CTP synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-149 |
sp|A6VR01|PYRG_ACTSZ | CTP synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-149 |
sp|A9AGW0|PYRG_BURM1 | CTP synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-149 |
sp|Q74LG2|PYRG_LACJO | CTP synthase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pyrG PE=3 SV=1 | 1 | 556 | 2.0E-149 |
sp|Q39EV7|PYRG_BURL3 | CTP synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-149 |
sp|B0SYY1|PYRG_CAUSK | CTP synthase OS=Caulobacter sp. (strain K31) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-149 |
sp|Q3AGF7|PYRG_SYNSC | CTP synthase OS=Synechococcus sp. (strain CC9605) GN=pyrG PE=3 SV=1 | 1 | 567 | 3.0E-149 |
sp|A0KU81|PYRG_SHESA | CTP synthase OS=Shewanella sp. (strain ANA-3) GN=pyrG PE=3 SV=1 | 3 | 559 | 3.0E-149 |
sp|C1DCC1|PYRG_LARHH | CTP synthase OS=Laribacter hongkongensis (strain HLHK9) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-149 |
sp|Q5LTV0|PYRG_RUEPO | CTP synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-149 |
sp|Q3SL45|PYRG_THIDA | CTP synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-149 |
sp|Q83B36|PYRG_COXBU | CTP synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pyrG PE=3 SV=1 | 1 | 552 | 4.0E-149 |
sp|Q7MAI3|PYRG_WOLSU | CTP synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=pyrG PE=3 SV=1 | 3 | 564 | 4.0E-149 |
sp|Q9A7K3|PYRG_CAUCR | CTP synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-149 |
sp|B8GW64|PYRG_CAUCN | CTP synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-149 |
sp|A9KDH0|PYRG_COXBN | CTP synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pyrG PE=3 SV=1 | 1 | 552 | 6.0E-149 |
sp|B1Y4K6|PYRG_LEPCP | CTP synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pyrG PE=3 SV=1 | 1 | 541 | 6.0E-149 |
sp|B8D7U6|PYRG_BUCAT | CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pyrG PE=3 SV=1 | 4 | 553 | 6.0E-149 |
sp|Q6MUA3|PYRG_MYCMS | CTP synthase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=pyrG PE=3 SV=1 | 1 | 552 | 7.0E-149 |
sp|Q2KZF8|PYRG_BORA1 | CTP synthase OS=Bordetella avium (strain 197N) GN=pyrG PE=3 SV=1 | 1 | 559 | 7.0E-149 |
sp|A2BTS1|PYRG_PROMS | CTP synthase OS=Prochlorococcus marinus (strain AS9601) GN=pyrG PE=3 SV=1 | 1 | 562 | 7.0E-149 |
sp|Q64T27|PYRG_BACFR | CTP synthase OS=Bacteroides fragilis (strain YCH46) GN=pyrG PE=3 SV=1 | 3 | 553 | 7.0E-149 |
sp|Q5LC42|PYRG_BACFN | CTP synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pyrG PE=3 SV=1 | 3 | 553 | 7.0E-149 |
sp|P57491|PYRG_BUCAI | CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pyrG PE=3 SV=1 | 4 | 553 | 8.0E-149 |
sp|Q3B6P1|PYRG_CHLL7 | CTP synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=pyrG PE=3 SV=1 | 2 | 565 | 9.0E-149 |
sp|B1JK10|PYRG_YERPY | CTP synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pyrG PE=3 SV=1 | 3 | 554 | 9.0E-149 |
sp|Q66ED9|PYRG_YERPS | CTP synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pyrG PE=3 SV=1 | 3 | 554 | 9.0E-149 |
sp|A4TPY0|PYRG_YERPP | CTP synthase OS=Yersinia pestis (strain Pestoides F) GN=pyrG PE=3 SV=1 | 3 | 554 | 9.0E-149 |
sp|Q1CLT3|PYRG_YERPN | CTP synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pyrG PE=3 SV=1 | 3 | 554 | 9.0E-149 |
sp|A9R1D2|PYRG_YERPG | CTP synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pyrG PE=3 SV=1 | 3 | 554 | 9.0E-149 |
sp|Q8ZBN1|PYRG_YERPE | CTP synthase OS=Yersinia pestis GN=pyrG PE=3 SV=3 | 3 | 554 | 9.0E-149 |
sp|B2K560|PYRG_YERPB | CTP synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pyrG PE=3 SV=1 | 3 | 554 | 9.0E-149 |
sp|Q1C3Y5|PYRG_YERPA | CTP synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pyrG PE=3 SV=1 | 3 | 554 | 9.0E-149 |
sp|A7FLZ6|PYRG_YERP3 | CTP synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pyrG PE=3 SV=1 | 3 | 554 | 9.0E-149 |
sp|Q0I200|PYRG_HAES1 | CTP synthase OS=Haemophilus somnus (strain 129Pt) GN=pyrG PE=3 SV=2 | 3 | 554 | 9.0E-149 |
sp|Q4JAK8|PYRG_SULAC | CTP synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pyrG PE=3 SV=1 | 1 | 555 | 1.0E-148 |
sp|Q310T4|PYRG_DESAG | CTP synthase OS=Desulfovibrio alaskensis (strain G20) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-148 |
sp|B8GQ73|PYRG_THISH | CTP synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-148 |
sp|B3EE77|PYRG_CHLL2 | CTP synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=pyrG PE=3 SV=1 | 2 | 553 | 1.0E-148 |
sp|B1KPT7|PYRG_SHEWM | CTP synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pyrG PE=3 SV=1 | 3 | 550 | 2.0E-148 |
sp|Q0I677|PYRG_SYNS3 | CTP synthase OS=Synechococcus sp. (strain CC9311) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-148 |
sp|Q0C195|PYRG_HYPNA | CTP synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-148 |
sp|Q7U3K4|PYRG_SYNPX | CTP synthase OS=Synechococcus sp. (strain WH8102) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-148 |
sp|B6J4W8|PYRG_COXB1 | CTP synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=pyrG PE=3 SV=1 | 1 | 552 | 2.0E-148 |
sp|A4SRC2|PYRG_AERS4 | CTP synthase OS=Aeromonas salmonicida (strain A449) GN=pyrG PE=3 SV=1 | 3 | 553 | 2.0E-148 |
sp|Q1GBQ2|PYRG_LACDA | CTP synthase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pyrG PE=3 SV=1 | 1 | 556 | 3.0E-148 |
sp|B4T484|PYRG_SALNS | CTP synthase OS=Salmonella newport (strain SL254) GN=pyrG PE=3 SV=1 | 3 | 553 | 3.0E-148 |
sp|Q30NS7|PYRG_SULDN | CTP synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-148 |
sp|Q3ZYU1|PYRG_DEHMC | CTP synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=pyrG PE=3 SV=1 | 1 | 564 | 3.0E-148 |
sp|A5FPS8|PYRG_DEHMB | CTP synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pyrG PE=3 SV=1 | 1 | 564 | 3.0E-148 |
sp|B4TTY6|PYRG_SALSV | CTP synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=pyrG PE=3 SV=1 | 3 | 554 | 3.0E-148 |
sp|B8D9J4|PYRG_BUCA5 | CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pyrG PE=3 SV=1 | 4 | 553 | 3.0E-148 |
sp|B3QRL0|PYRG_CHLP8 | CTP synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=pyrG PE=3 SV=1 | 2 | 553 | 4.0E-148 |
sp|O26519|PYRG_METTH | CTP synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pyrG PE=3 SV=1 | 1 | 559 | 4.0E-148 |
sp|Q7UZH7|PYRG_PROMP | CTP synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=pyrG PE=3 SV=1 | 1 | 559 | 4.0E-148 |
sp|Q0BTX6|PYRG_GRABC | CTP synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-148 |
sp|A1VDL2|PYRG_DESVV | CTP synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-148 |
sp|Q72BL2|PYRG_DESVH | CTP synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-148 |
sp|A5GPM2|PYRG_SYNPW | CTP synthase OS=Synechococcus sp. (strain WH7803) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-148 |
sp|Q1H009|PYRG_METFK | CTP synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-148 |
sp|A1JJR3|PYRG_YERE8 | CTP synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pyrG PE=3 SV=1 | 3 | 554 | 5.0E-148 |
sp|Q21V39|PYRG_RHOFT | CTP synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-148 |
sp|P65921|PYRG_SALTY | CTP synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pyrG PE=3 SV=2 | 3 | 553 | 5.0E-148 |
sp|P65922|PYRG_SALTI | CTP synthase OS=Salmonella typhi GN=pyrG PE=3 SV=2 | 3 | 553 | 5.0E-148 |
sp|C0PXD6|PYRG_SALPC | CTP synthase OS=Salmonella paratyphi C (strain RKS4594) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-148 |
sp|A9N2F5|PYRG_SALPB | CTP synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-148 |
sp|B4TFZ2|PYRG_SALHS | CTP synthase OS=Salmonella heidelberg (strain SL476) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-148 |
sp|B5RDS6|PYRG_SALG2 | CTP synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-148 |
sp|B5QW41|PYRG_SALEP | CTP synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-148 |
sp|B5FTV0|PYRG_SALDC | CTP synthase OS=Salmonella dublin (strain CT_02021853) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-148 |
sp|Q57KG9|PYRG_SALCH | CTP synthase OS=Salmonella choleraesuis (strain SC-B67) GN=pyrG PE=3 SV=1 | 3 | 553 | 5.0E-148 |
sp|A3PFH8|PYRG_PROM0 | CTP synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=pyrG PE=3 SV=1 | 1 | 562 | 6.0E-148 |
sp|Q6AGG5|PYRG_LEIXX | CTP synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pyrG PE=3 SV=2 | 3 | 559 | 6.0E-148 |
sp|A9M0Y3|PYRG_NEIM0 | CTP synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-148 |
sp|Q1CUG1|PYRG_HELPH | CTP synthase OS=Helicobacter pylori (strain HPAG1) GN=pyrG PE=3 SV=1 | 3 | 553 | 7.0E-148 |
sp|A8G9W0|PYRG_SERP5 | CTP synthase OS=Serratia proteamaculans (strain 568) GN=pyrG PE=3 SV=1 | 3 | 554 | 7.0E-148 |
sp|B6J3W7|PYRG_COXB2 | CTP synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=pyrG PE=3 SV=1 | 1 | 552 | 7.0E-148 |
sp|Q6MPP0|PYRG_BDEBA | CTP synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pyrG PE=3 SV=2 | 3 | 553 | 7.0E-148 |
sp|O25116|PYRG_HELPY | CTP synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pyrG PE=3 SV=1 | 3 | 553 | 8.0E-148 |
sp|Q4JVX2|PYRG_CORJK | CTP synthase OS=Corynebacterium jeikeium (strain K411) GN=pyrG PE=3 SV=1 | 3 | 553 | 9.0E-148 |
sp|Q04C51|PYRG_LACDB | CTP synthase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=pyrG PE=3 SV=1 | 1 | 556 | 9.0E-148 |
sp|A9N9V5|PYRG_COXBR | CTP synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pyrG PE=3 SV=1 | 1 | 552 | 9.0E-148 |
sp|A1WL89|PYRG_VEREI | CTP synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pyrG PE=3 SV=1 | 1 | 553 | 9.0E-148 |
sp|C4K4K0|PYRG_HAMD5 | CTP synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-147 |
sp|B3QWC0|PYRG_CHLT3 | CTP synthase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=pyrG PE=3 SV=1 | 1 | 561 | 1.0E-147 |
sp|A6TD54|PYRG_KLEP7 | CTP synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pyrG PE=3 SV=1 | 3 | 554 | 1.0E-147 |
sp|Q48965|PYRG_MYCCT | CTP synthase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pyrG PE=3 SV=3 | 1 | 552 | 1.0E-147 |
sp|Q3Z6N1|PYRG_DEHM1 | CTP synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pyrG PE=3 SV=1 | 1 | 564 | 1.0E-147 |
sp|B5BF03|PYRG_SALPK | CTP synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-147 |
sp|Q5PEJ0|PYRG_SALPA | CTP synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-147 |
sp|B5F4P0|PYRG_SALA4 | CTP synthase OS=Salmonella agona (strain SL483) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-147 |
sp|B6IQ27|PYRG_RHOCS | CTP synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-147 |
sp|A7MQY9|PYRG_CROS8 | CTP synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pyrG PE=3 SV=1 | 3 | 554 | 1.0E-147 |
sp|A2BZ76|PYRG_PROM5 | CTP synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-147 |
sp|Q2NVN8|PYRG_SODGM | CTP synthase OS=Sodalis glossinidius (strain morsitans) GN=pyrG PE=3 SV=1 | 3 | 554 | 2.0E-147 |
sp|Q11HU6|PYRG_CHESB | CTP synthase OS=Chelativorans sp. (strain BNC1) GN=pyrG PE=3 SV=2 | 1 | 553 | 2.0E-147 |
sp|A1KUX8|PYRG_NEIMF | CTP synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-147 |
sp|A8G7J4|PYRG_PROM2 | CTP synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-147 |
sp|Q9JYJ8|PYRG_NEIMB | CTP synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-147 |
sp|B5FAG0|PYRG_VIBFM | CTP synthase OS=Vibrio fischeri (strain MJ11) GN=pyrG PE=3 SV=1 | 4 | 554 | 2.0E-147 |
sp|A9MF10|PYRG_SALAR | CTP synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pyrG PE=3 SV=1 | 3 | 554 | 2.0E-147 |
sp|Q9JTK1|PYRG_NEIMA | CTP synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-147 |
sp|A4WDW8|PYRG_ENT38 | CTP synthase OS=Enterobacter sp. (strain 638) GN=pyrG PE=3 SV=1 | 3 | 554 | 3.0E-147 |
sp|Q1MR71|PYRG_LAWIP | CTP synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=pyrG PE=3 SV=1 | 3 | 554 | 3.0E-147 |
sp|Q3AUG4|PYRG_SYNS9 | CTP synthase OS=Synechococcus sp. (strain CC9902) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-147 |
sp|Q9ZM99|PYRG_HELPJ | CTP synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pyrG PE=3 SV=1 | 3 | 553 | 4.0E-147 |
sp|Q5E325|PYRG_VIBF1 | CTP synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pyrG PE=3 SV=1 | 4 | 554 | 4.0E-147 |
sp|Q87LP9|PYRG_VIBPA | CTP synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pyrG PE=3 SV=1 | 4 | 554 | 4.0E-147 |
sp|B5XV18|PYRG_KLEP3 | CTP synthase OS=Klebsiella pneumoniae (strain 342) GN=pyrG PE=3 SV=1 | 3 | 554 | 5.0E-147 |
sp|A8ANY8|PYRG_CITK8 | CTP synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pyrG PE=3 SV=1 | 3 | 554 | 5.0E-147 |
sp|B2I2A7|PYRG_ACIBC | CTP synthase OS=Acinetobacter baumannii (strain ACICU) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-147 |
sp|A5EW22|PYRG_DICNV | CTP synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-147 |
sp|Q1GTY6|PYRG_SPHAL | CTP synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-147 |
sp|C6DDJ6|PYRG_PECCP | CTP synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pyrG PE=3 SV=1 | 3 | 559 | 6.0E-147 |
sp|A4SCI7|PYRG_CHLPM | CTP synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=pyrG PE=3 SV=1 | 2 | 553 | 6.0E-147 |
sp|Q317V2|PYRG_PROM9 | CTP synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=pyrG PE=3 SV=1 | 1 | 553 | 7.0E-147 |
sp|Q5NZ71|PYRG_AROAE | CTP synthase OS=Aromatoleum aromaticum (strain EbN1) GN=pyrG PE=3 SV=1 | 1 | 551 | 7.0E-147 |
sp|Q128E7|PYRG_POLSJ | CTP synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pyrG PE=3 SV=1 | 1 | 537 | 1.0E-146 |
sp|A1BJR8|PYRG_CHLPD | CTP synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=pyrG PE=3 SV=1 | 2 | 553 | 1.0E-146 |
sp|Q2W6A0|PYRG_MAGSA | CTP synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-146 |
sp|Q4FR69|PYRG_PSYA2 | CTP synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-146 |
sp|B0V675|PYRG_ACIBY | CTP synthase OS=Acinetobacter baumannii (strain AYE) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-146 |
sp|A3M5Y3|PYRG_ACIBT | CTP synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pyrG PE=3 SV=2 | 1 | 553 | 2.0E-146 |
sp|B0VQI6|PYRG_ACIBS | CTP synthase OS=Acinetobacter baumannii (strain SDF) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-146 |
sp|B7I920|PYRG_ACIB5 | CTP synthase OS=Acinetobacter baumannii (strain AB0057) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-146 |
sp|B7H225|PYRG_ACIB3 | CTP synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-146 |
sp|Q6D181|PYRG_PECAS | CTP synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pyrG PE=3 SV=1 | 3 | 559 | 2.0E-146 |
sp|Q47WQ9|PYRG_COLP3 | CTP synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pyrG PE=3 SV=1 | 3 | 553 | 3.0E-146 |
sp|A4SXE7|PYRG_POLSQ | CTP synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-146 |
sp|Q1LTN7|PYRG_BAUCH | CTP synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pyrG PE=3 SV=1 | 3 | 554 | 3.0E-146 |
sp|B2VFY9|PYRG_ERWT9 | CTP synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pyrG PE=3 SV=1 | 3 | 562 | 4.0E-146 |
sp|Q9YBJ4|PYRG_AERPE | CTP synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pyrG PE=3 SV=1 | 3 | 554 | 4.0E-146 |
sp|A7MTS6|PYRG_VIBCB | CTP synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pyrG PE=3 SV=1 | 4 | 554 | 4.0E-146 |
sp|Q1Q9K1|PYRG_PSYCK | CTP synthase OS=Psychrobacter cryohalolentis (strain K5) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-146 |
sp|B4RJ40|PYRG_NEIG2 | CTP synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-146 |
sp|Q5F7G6|PYRG_NEIG1 | CTP synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pyrG PE=3 SV=1 | 1 | 553 | 4.0E-146 |
sp|Q5R142|PYRG_IDILO | CTP synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pyrG PE=3 SV=1 | 3 | 554 | 5.0E-146 |
sp|A1SJK4|PYRG_NOCSJ | CTP synthase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pyrG PE=3 SV=1 | 3 | 559 | 6.0E-146 |
sp|B6EKL9|PYRG_ALISL | CTP synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=pyrG PE=3 SV=1 | 3 | 554 | 7.0E-146 |
sp|Q3JCT3|PYRG_NITOC | CTP synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pyrG PE=3 SV=1 | 1 | 561 | 8.0E-146 |
sp|Q2GHT7|PYRG_EHRCR | CTP synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=pyrG PE=3 SV=1 | 3 | 553 | 9.0E-146 |
sp|B4EUF6|PYRG_PROMH | CTP synthase OS=Proteus mirabilis (strain HI4320) GN=pyrG PE=3 SV=1 | 3 | 553 | 9.0E-146 |
sp|Q9CI75|PYRG_LACLA | CTP synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-145 |
sp|P59040|PYRG_CHLTE | CTP synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pyrG PE=3 SV=1 | 2 | 553 | 1.0E-145 |
sp|A1K7F8|PYRG_AZOSB | CTP synthase OS=Azoarcus sp. (strain BH72) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-145 |
sp|A5G5T3|PYRG_GEOUR | CTP synthase OS=Geobacter uraniireducens (strain Rf4) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-145 |
sp|Q2IWB8|PYRG_RHOP2 | CTP synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-145 |
sp|A6SXG2|PYRG_JANMA | CTP synthase OS=Janthinobacterium sp. (strain Marseille) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-145 |
sp|Q83IC4|PYRG_TROW8 | CTP synthase OS=Tropheryma whipplei (strain TW08/27) GN=pyrG PE=3 SV=1 | 2 | 572 | 2.0E-145 |
sp|Q6G027|PYRG_BARQU | CTP synthase OS=Bartonella quintana (strain Toulouse) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-145 |
sp|C6BWN7|PYRG_DESAD | CTP synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=pyrG PE=3 SV=1 | 3 | 554 | 2.0E-145 |
sp|C3LQZ1|PYRG_VIBCM | CTP synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pyrG PE=3 SV=1 | 3 | 554 | 2.0E-145 |
sp|Q9KPC4|PYRG_VIBCH | CTP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pyrG PE=3 SV=3 | 3 | 554 | 2.0E-145 |
sp|A5F5I4|PYRG_VIBC3 | CTP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pyrG PE=3 SV=1 | 3 | 554 | 2.0E-145 |
sp|Q1GF61|PYRG_RUEST | CTP synthase OS=Ruegeria sp. (strain TM1040) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-145 |
sp|Q47DH9|PYRG_DECAR | CTP synthase OS=Dechloromonas aromatica (strain RCB) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-145 |
sp|B1VAI9|PYRG_PHYAS | CTP synthase OS=Phytoplasma australiense GN=pyrG PE=3 SV=1 | 3 | 553 | 3.0E-145 |
sp|Q83GX8|PYRG_TROWT | CTP synthase OS=Tropheryma whipplei (strain Twist) GN=pyrG PE=3 SV=1 | 2 | 572 | 3.0E-145 |
sp|Q8YHF2|PYRG_BRUME | CTP synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-145 |
sp|B2A3K5|PYRG_NATTJ | CTP synthase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pyrG PE=3 SV=1 | 1 | 553 | 3.0E-145 |
sp|A5WG19|PYRG_PSYWF | CTP synthase OS=Psychrobacter sp. (strain PRwf-1) GN=pyrG PE=3 SV=1 | 1 | 553 | 5.0E-145 |
sp|O87761|PYRG_LACLM | CTP synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pyrG PE=3 SV=2 | 3 | 553 | 5.0E-145 |
sp|B7UHJ6|PYRG_ECO27 | CTP synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pyrG PE=3 SV=1 | 3 | 554 | 5.0E-145 |
sp|Q73J84|PYRG_TREDE | CTP synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=pyrG PE=3 SV=1 | 3 | 562 | 5.0E-145 |
sp|C5B8X3|PYRG_EDWI9 | CTP synthase OS=Edwardsiella ictaluri (strain 93-146) GN=pyrG PE=3 SV=1 | 3 | 554 | 8.0E-145 |
sp|B9M9Q5|PYRG_GEODF | CTP synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=pyrG PE=3 SV=1 | 3 | 553 | 8.0E-145 |
sp|Q8F3J3|PYRG_LEPIN | CTP synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pyrG PE=3 SV=2 | 3 | 553 | 1.0E-144 |
sp|Q72S46|PYRG_LEPIC | CTP synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pyrG PE=3 SV=2 | 3 | 553 | 1.0E-144 |
sp|Q5FFC3|PYRG_EHRRG | CTP synthase OS=Ehrlichia ruminantium (strain Gardel) GN=pyrG PE=3 SV=1 | 3 | 553 | 1.0E-144 |
sp|B0U802|PYRG_METS4 | CTP synthase OS=Methylobacterium sp. (strain 4-46) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-144 |
sp|Q2NK04|PYRG_AYWBP | CTP synthase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=pyrG PE=3 SV=2 | 3 | 553 | 1.0E-144 |
sp|P52200|PYRG_SPICI | CTP synthase OS=Spiroplasma citri GN=pyrG PE=3 SV=1 | 1 | 552 | 1.0E-144 |
sp|A1B8D4|PYRG_PARDP | CTP synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-144 |
sp|B1XUS0|PYRG_POLNS | CTP synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=pyrG PE=3 SV=1 | 1 | 553 | 1.0E-144 |
sp|A8LIN6|PYRG_DINSH | CTP synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pyrG PE=3 SV=1 | 1 | 553 | 2.0E-144 |
sp|Q3YY76|PYRG_SHISS | CTP synthase OS=Shigella sonnei (strain Ss046) GN=pyrG PE=3 SV=1 | 3 | 554 | 2.0E-144 |
sp|P0A7E8|PYRG_SHIFL | CTP synthase OS=Shigella flexneri GN=pyrG PE=3 SV=2 | 3 | 554 | 2.0E-144 |
sp|Q0T1P8|PYRG_SHIF8 | CTP synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=pyrG PE=3 SV=1 | 3 | 554 | 2.0E-144 |
sp|Q32CD5|PYRG_SHIDS | CTP synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pyrG PE=3 SV=1 | 3 | 554 | 2.0E-144 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003883 | CTP synthase activity | Yes |
GO:0016787 | hydrolase activity | Yes |
GO:0006221 | pyrimidine nucleotide biosynthetic process | Yes |
GO:0006753 | nucleoside phosphate metabolic process | No |
GO:0072528 | pyrimidine-containing compound biosynthetic process | No |
GO:0008152 | metabolic process | No |
GO:0034654 | nucleobase-containing compound biosynthetic process | No |
GO:0009987 | cellular process | No |
GO:0006139 | nucleobase-containing compound metabolic process | No |
GO:0019637 | organophosphate metabolic process | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:1901360 | organic cyclic compound metabolic process | No |
GO:0006793 | phosphorus metabolic process | No |
GO:0003824 | catalytic activity | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0009058 | biosynthetic process | No |
GO:0008150 | biological_process | No |
GO:0046483 | heterocycle metabolic process | No |
GO:0009165 | nucleotide biosynthetic process | No |
GO:1901293 | nucleoside phosphate biosynthetic process | No |
GO:0009117 | nucleotide metabolic process | No |
GO:0055086 | nucleobase-containing small molecule metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0006725 | cellular aromatic compound metabolic process | No |
GO:0003674 | molecular_function | No |
GO:0044281 | small molecule metabolic process | No |
GO:0006796 | phosphate-containing compound metabolic process | No |
GO:0019438 | aromatic compound biosynthetic process | No |
GO:0018130 | heterocycle biosynthetic process | No |
GO:0016874 | ligase activity | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0090407 | organophosphate biosynthetic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0044238 | primary metabolic process | No |
GO:0072527 | pyrimidine-containing compound metabolic process | No |
GO:0006220 | pyrimidine nucleotide metabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:1901362 | organic cyclic compound biosynthetic process | No |
GO:0016879 | ligase activity, forming carbon-nitrogen bonds | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 38 | 0.45 |
Domain # | Start | End | Length |
---|---|---|---|
1 | 5 | 27 | 22 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|4558 MMKYVLVSGGVVSGVGKGIIASSAGLLLKTIGLKVTAIKIDPYINVDAGTMNPKEHGECFVLQDGGESDLDLGNY ERYLGLDLTRDNNITTGKIYKHVIEKERRGDYLGRTVQVVPHVTSAIIDHIERVSKISVDRSGSEPDVCIVELGG TVGDIESMPFVEALTQLRHKAGKGNFINIHVSYVPIVNGEQKTKPTQHAVKSVRMAGLIPDLIACRCERPLEKVT IGKIASNCQVEVEQVVAVRDMPTIYQVPILLEQQGLLELLTQALKLDEVSLTPSLVSKGAEIWKKWNMIIPQEHS ERIDIALVGKYVELPDAYLSVVKSLEHSAMRCGRKLNLIWVDSEQLEDKTQKSDPVGFYKAWHQVSTAAGILVPG GFGLRGTEGMIKAAQWARERKAPFLGICLGMQIAVIEFARDVCGRANATSEEFDARAEHRLIVFMPEGSKETMGG TMRLGSRATHFQPGSDYSKLRALYGEATVIEERHRHRYEVNPEYVQELEAAGMTFIGKDDTGNRMEIFELHDHPW FVGVQYHPEYMSRVLDPSRPYLGFVAAAAGCLDRITRDALNEGTLIVNGVADESQF* |
Coding | >Hirsu2|4558 ATGATGAAATACGTTCTGGTGTCCGGAGGTGTGGTGAGCGGTGTTGGCAAGGGCATCATAGCCTCGTCGGCGGGG CTGTTACTCAAGACGATTGGCCTGAAAGTCACGGCCATCAAGATCGACCCGTACATCAACGTCGATGCCGGGACG ATGAACCCCAAAGAGCATGGAGAATGTTTCGTGTTGCAGGATGGCGGAGAGTCTGATCTAGACCTTGGAAACTAT GAGCGCTACCTGGGCCTGGACCTCACGCGGGACAACAACATCACCACAGGCAAGATATACAAGCACGTCATTGAA AAGGAGCGCAGGGGCGATTACCTGGGCCGCACCGTCCAGGTCGTCCCGCATGTCACCTCGGCCATCATCGACCAC ATTGAGCGTGTGTCAAAGATCTCCGTCGACAGGTCCGGCTCGGAGCCAGATGTGTGCATCGTCGAGTTGGGCGGG ACCGTCGGCGACATCGAGAGTATGCCCTTTGTGGAGGCGCTCACCCAACTTCGACACAAGGCCGGCAAAGGCAAC TTCATCAACATCCACGTCTCGTACGTCCCCATTGTCAACGGGGAGCAGAAGACGAAGCCCACGCAGCACGCGGTG AAAAGCGTCCGGATGGCTGGTCTCATTCCTGACTTGATTGCTTGTCGCTGCGAGCGGCCGCTGGAGAAGGTGACG ATAGGCAAGATCGCGTCGAACTGCCAAGTCGAGGTTGAACAGGTTGTTGCCGTCCGAGACATGCCCACCATCTAC CAAGTCCCCATACTGCTGGAGCAGCAAGGCCTGTTGGAGCTCCTGACGCAGGCGCTTAAGTTGGACGAGGTATCG CTGACGCCGTCGCTGGTTTCGAAAGGAGCAGAGATTTGGAAGAAGTGGAACATGATCATTCCACAAGAACACTCG GAGAGGATCGACATCGCCCTCGTGGGCAAGTACGTCGAGCTTCCGGACGCCTACCTGTCCGTCGTCAAGTCGCTG GAGCACTCAGCCATGCGGTGCGGCCGCAAGCTGAATCTGATCTGGGTCGACTCGGAGCAGCTGGAGGACAAGACG CAGAAGAGCGACCCGGTCGGCTTCTACAAGGCGTGGCACCAGGTCTCGACCGCGGCCGGCATCCTAGTGCCCGGC GGCTTCGGCCTGCGCGGGACGGAGGGCATGATTAAGGCGGCGCAGTGGGCGCGCGAACGTAAGGCGCCCTTCCTC GGCATCTGCCTGGGTATGCAGATCGCCGTGATCGAGTTTGCGCGGGACGTGTGCGGGCGGGCCAACGCGACGTCG GAAGAGTTCGACGCCCGGGCTGAGCACCGGCTCATCGTCTTCATGCCTGAGGGCTCCAAGGAGACGATGGGCGGC ACGATGCGGCTGGGCTCGCGCGCGACGCACTTTCAGCCTGGCAGCGATTACAGCAAGCTGCGGGCTCTGTACGGC GAGGCTACCGTCATCGAGGAGCGCCACCGCCATCGCTACGAGGTCAACCCAGAGTACGTGCAAGAGCTCGAGGCC GCCGGCATGACCTTCATCGGCAAAGACGACACAGGCAACCGCATGGAGATCTTTGAGCTGCACGACCACCCGTGG TTCGTCGGCGTGCAGTACCACCCCGAGTACATGAGCCGCGTGCTGGACCCGTCGCGGCCGTACCTGGGCTTTGTC GCCGCCGCCGCCGGCTGCCTTGACCGCATCACGCGCGACGCTCTCAATGAGGGCACCCTGATCGTCAACGGCGTC GCCGACGAGTCGCAGTTCTGA |
Transcript | >Hirsu2|4558 ATGATGAAATACGTTCTGGTGTCCGGAGGTGTGGTGAGCGGTGTTGGCAAGGGCATCATAGCCTCGTCGGCGGGG CTGTTACTCAAGACGATTGGCCTGAAAGTCACGGCCATCAAGATCGACCCGTACATCAACGTCGATGCCGGGACG ATGAACCCCAAAGAGCATGGAGAATGTTTCGTGTTGCAGGATGGCGGAGAGTCTGATCTAGACCTTGGAAACTAT GAGCGCTACCTGGGCCTGGACCTCACGCGGGACAACAACATCACCACAGGCAAGATATACAAGCACGTCATTGAA AAGGAGCGCAGGGGCGATTACCTGGGCCGCACCGTCCAGGTCGTCCCGCATGTCACCTCGGCCATCATCGACCAC ATTGAGCGTGTGTCAAAGATCTCCGTCGACAGGTCCGGCTCGGAGCCAGATGTGTGCATCGTCGAGTTGGGCGGG ACCGTCGGCGACATCGAGAGTATGCCCTTTGTGGAGGCGCTCACCCAACTTCGACACAAGGCCGGCAAAGGCAAC TTCATCAACATCCACGTCTCGTACGTCCCCATTGTCAACGGGGAGCAGAAGACGAAGCCCACGCAGCACGCGGTG AAAAGCGTCCGGATGGCTGGTCTCATTCCTGACTTGATTGCTTGTCGCTGCGAGCGGCCGCTGGAGAAGGTGACG ATAGGCAAGATCGCGTCGAACTGCCAAGTCGAGGTTGAACAGGTTGTTGCCGTCCGAGACATGCCCACCATCTAC CAAGTCCCCATACTGCTGGAGCAGCAAGGCCTGTTGGAGCTCCTGACGCAGGCGCTTAAGTTGGACGAGGTATCG CTGACGCCGTCGCTGGTTTCGAAAGGAGCAGAGATTTGGAAGAAGTGGAACATGATCATTCCACAAGAACACTCG GAGAGGATCGACATCGCCCTCGTGGGCAAGTACGTCGAGCTTCCGGACGCCTACCTGTCCGTCGTCAAGTCGCTG GAGCACTCAGCCATGCGGTGCGGCCGCAAGCTGAATCTGATCTGGGTCGACTCGGAGCAGCTGGAGGACAAGACG CAGAAGAGCGACCCGGTCGGCTTCTACAAGGCGTGGCACCAGGTCTCGACCGCGGCCGGCATCCTAGTGCCCGGC GGCTTCGGCCTGCGCGGGACGGAGGGCATGATTAAGGCGGCGCAGTGGGCGCGCGAACGTAAGGCGCCCTTCCTC GGCATCTGCCTGGGTATGCAGATCGCCGTGATCGAGTTTGCGCGGGACGTGTGCGGGCGGGCCAACGCGACGTCG GAAGAGTTCGACGCCCGGGCTGAGCACCGGCTCATCGTCTTCATGCCTGAGGGCTCCAAGGAGACGATGGGCGGC ACGATGCGGCTGGGCTCGCGCGCGACGCACTTTCAGCCTGGCAGCGATTACAGCAAGCTGCGGGCTCTGTACGGC GAGGCTACCGTCATCGAGGAGCGCCACCGCCATCGCTACGAGGTCAACCCAGAGTACGTGCAAGAGCTCGAGGCC GCCGGCATGACCTTCATCGGCAAAGACGACACAGGCAACCGCATGGAGATCTTTGAGCTGCACGACCACCCGTGG TTCGTCGGCGTGCAGTACCACCCCGAGTACATGAGCCGCGTGCTGGACCCGTCGCGGCCGTACCTGGGCTTTGTC GCCGCCGCCGCCGGCTGCCTTGACCGCATCACGCGCGACGCTCTCAATGAGGGCACCCTGATCGTCAACGGCGTC GCCGACGAGTCGCAGTTCTGA |
Gene | >Hirsu2|4558 ATGATGAAATACGTTCTGGTGTCCGGAGGTCAGCATCCCAAGCGTCTCACTCAACCTTCTCGTCCTCTTTATATT CGGTTTTCATCGCCCCCCAAGCTCGTTAAAAAAATCTCAAGATCGCGCTGGACACGGCCAGTGTATCGAACCTTT CGCTAACGCGGGGCCTGCAGGTGTGGTGAGCGGTGTTGGCAAGGGCATCATAGGTATACACATATTAATATGCGT GCCCAAAGAATCGCATCGCCCTGGGACATGGGTTCGATAATCGTTCGCTAACATGCTGAAGCCTCGTCGGCGGGG CTGTTACTCAAGACGATTGGCCTGAAAGTCACGGTATGTCCTCTGATACCCGCACCGGCGGCATGGCTGTGGCTT TGCGTGTGCGTGCTGATGCGTCGAGTCTAGGCCATCAAGATCGACCCGTACATCAACGTCGATGCCGGGACGATG AACCCCAAAGAGTGAGGCAGCCCCTCTCTGCATGTTCATACCATCGCGGATTGATGCTCCAGCGGGAGTCGCTTA CTGACAGTCTGGCCCAAGGCATGGAGAATGTTTCGTGTTGCAGGATGGCGGAGAGTCTGATCTAGACCTTGGAAA CTATGAGCGGTACGCCAGCCATATTTTTAACAGTCTAAGTTGGTTTCTTTGCCCGGACCGAGTCGCTGACCGTGA AAGCTACCTGGGCCTGGACCTCACGCGGGACAACAACATCACCACAGGCAAGATATACAAGCACGTCATTGAAAA GGAGCGCAGGGGCGATTACCTGGGCCGCACCGTCCAGGTCGTCCCGCATGTCACCTCGGCCATCATCGACCACAT TGAGCGTGTGTCAAAGATCTCCGTCGACAGGTCCGGCTCGGAGCCAGATGTGTGCATCGGTACGTTGGTCGAAGA CGCGCGGCTCTGGCCTCACCCACTCCACTAACTCGAGTCCTCAGTCGAGTTGGTACGCTCTGCTTCCCGCGTTGC GCGACGTCACGTCATTCCCCTTGGCCCTCGTGCCTTAACACGTCTGGTGCAAAGCTCTAACACGCCGTCAAGGGC GGGACCGTCGGCGACATCGAGAGTATGCCCTTTGTGGAGGCGCTCACCCAACTTCGACACAAGGCCGGCAAAGGC AACTTCATCAACATCCACGTCTCGTACGTCCCCATTGTCAACGGGGAGCAGAAGACGAAGCCCACGCAGCACGCG GTGAAAAGCGTCCGGATGGCTGGTCTCATTCCTGACTTGGTAAGACCCCCCCTTCTCCCGACAATGACGACGAAT CGGAACGCCATGTCAGCCGATACTCACAGTCGGTGCCTACAGATTGCTTGTCGCTGCGAGCGGCCGCTGGAGAAG GTGACGATAGGCAAGATCGCGTCGAACTGCCAAGTCGAGGTTGAACAGGTTGTTGCCGTCCGAGACATGCCCACC ATCTACCAAGTCCCCATACTGCTGGAGCAGCAAGGCCTGTTGGAGCTCCTGACGCAGGCGCTTAAGTTGGACGAG GTATCGCTGACGCCGTCGCTGGTTTCGAAAGGAGCAGAGATTTGGAAGAAGTGGAACATGATCATTCCACAAGAA CACTCGGAGAGGATCGACATCGCCCTCGTGGGCAAGTACGTCGAGCTTCCGGACGCCTACCTGTCCGTCGTCAAG TCGCTGGAGCACTCAGCCATGCGGTGCGGCCGCAAGCTGAATCTGATCTGGGTCGACTCGGAGCAGCTGGAGGAC AAGACGCAGAAGAGCGACCCGGTCGGCTTCTACAAGGCGTGGCACCAGGTCTCGACCGCGGCCGGCATCCTAGTG CCCGGCGGCTTCGGCCTGCGCGGGACGGAGGGCATGATTAAGGCGGCGCAGTGGGCGCGCGAACGTAAGGCGCCC TTCCTCGGCATCTGCCTGGGTATGCAGATCGCCGTGATCGAGTTTGCGCGGGACGTGTGCGGGCGGGCCAACGCG ACGTCGGAAGAGTTCGACGCCCGGGCTGAGCACCGGCTCATCGTCTTCATGCCTGAGGGCTCCAAGGAGACGATG GGCGGCACGATGCGGCTGGGCTCGCGCGCGACGCACTTTCAGCCTGGCAGCGATTACAGCAAGCTGCGGGCTCTG TACGGCGAGGCTACCGTCATCGAGGAGCGCCACCGCCATCGCTACGAGGTCAACCCAGAGTACGTGCAAGAGCTC GAGGCCGCCGGCATGACCTTCATCGGCAAAGACGACACAGGCAACCGCATGGAGATCTTTGAGCTGCACGACCAC CCGTGGTTCGTCGGCGTGCAGTACCACCCCGAGTACATGAGCCGCGTGCTGGACCCGTCGCGGCCGTACCTGGGC TTTGTCGCCGCCGCCGCCGGCTGCCTTGACCGCATCACGCGCGACGCTCTCAATGAGGGCACCCTGATCGTCAAC GGCGTCGCCGACGAGTCGCAGTTCTGA |