Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4530
Gene name
LocationContig_23:54226..54544
Strand+
Gene length (bp)318
Transcript length (bp)318
Coding sequence length (bp)318
Protein length (aa) 106

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 6.8E-28 5 99
PF13098 Thioredoxin_2 Thioredoxin-like domain 6.5E-07 18 91
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 2.0E-06 9 84
PF14595 Thioredoxin_9 Thioredoxin 2.7E-06 23 82

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 3 101 2.0E-28
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 3 100 2.0E-28
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 3 101 3.0E-28
sp|P50413|THIO_SHEEP Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 3 101 4.0E-28
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 3 101 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 3 101 2.0E-28
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 3 100 2.0E-28
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 3 101 3.0E-28
sp|P50413|THIO_SHEEP Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 3 101 4.0E-28
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 3 101 5.0E-28
sp|O65049|TRXH_PICMA Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 11 100 5.0E-28
sp|O97680|THIO_BOVIN Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 3 101 6.0E-28
sp|P29429|THIO_EMENI Thioredoxin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=TRX1 PE=1 SV=2 3 105 6.0E-28
sp|Q9BDJ3|THIO_CALJA Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 3 103 7.0E-28
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 6 97 1.0E-27
sp|P29451|THIO_MACMU Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 3 101 4.0E-27
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 3 101 5.0E-27
sp|Q38879|TRXH2_ARATH Thioredoxin H2 OS=Arabidopsis thaliana GN=TRX2 PE=2 SV=2 11 105 5.0E-27
sp|Q5R9M3|THIO_PONAB Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3 3 101 1.0E-26
sp|Q9DGI3|THIO_ICTPU Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 22 101 1.0E-25
sp|P11232|THIO_RAT Thioredoxin OS=Rattus norvegicus GN=Txn PE=1 SV=2 6 104 2.0E-25
sp|P10639|THIO_MOUSE Thioredoxin OS=Mus musculus GN=Txn PE=1 SV=3 6 104 3.0E-25
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 3 90 5.0E-25
sp|P08629|THIO_CHICK Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 22 100 3.0E-24
sp|Q851R5|TRH22_ORYSJ Thioredoxin H2-2 OS=Oryza sativa subsp. japonica GN=Os03g0800700 PE=2 SV=1 17 103 3.0E-24
sp|P25372|TRX3_YEAST Thioredoxin-3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX3 PE=1 SV=1 2 101 4.0E-24
sp|Q96419|TRXH_FAGES Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1 10 104 5.0E-24
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 3 101 6.0E-24
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 6 105 7.0E-24
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 11 100 1.0E-23
sp|Q98TX1|THIO_OPHHA Thioredoxin OS=Ophiophagus hannah GN=TXN PE=3 SV=3 14 103 1.0E-23
sp|A2YIW7|TRXH_ORYSI Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 22 100 4.0E-23
sp|Q0D840|TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 22 100 4.0E-23
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 1 103 6.0E-23
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 6 91 7.0E-23
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 1 103 8.0E-23
sp|Q6ES52|TDX_ORYSJ TPR repeat-containing thioredoxin TDX OS=Oryza sativa subsp. japonica GN=Os09g0401200 PE=2 SV=1 26 100 8.0E-23
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 1 105 8.0E-23
sp|P85801|TRXH_POPJC Thioredoxin H-type OS=Populus jackii PE=1 SV=1 2 100 9.0E-23
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 1 97 1.0E-22
sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1 10 100 1.0E-22
sp|P29448|TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1 7 100 2.0E-22
sp|O64432|TRXH_BRACM Thioredoxin H-type OS=Brassica campestris GN=PEC-2 PE=2 SV=1 11 100 2.0E-22
sp|Q9AS75|TRH41_ORYSJ Thioredoxin H4-1 OS=Oryza sativa subsp. japonica GN=Os01g0168200 PE=2 SV=1 22 100 2.0E-22
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 3 100 3.0E-22
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 9 100 4.0E-22
sp|Q39241|TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 10 100 5.0E-22
sp|P68176|TRXH_BRAOL Thioredoxin H-type OS=Brassica oleracea GN=BOPC17 PE=2 SV=1 11 100 7.0E-22
sp|P68177|TRXH1_BRANA Thioredoxin H-type 1 OS=Brassica napus GN=THL-1 PE=2 SV=1 11 100 7.0E-22
sp|O64394|TRXH_WHEAT Thioredoxin H-type OS=Triticum aestivum PE=2 SV=3 11 105 1.0E-21
sp|Q0DKF1|TRH42_ORYSJ Thioredoxin H4-2 OS=Oryza sativa subsp. japonica GN=Os05g0169000 PE=2 SV=1 6 104 2.0E-21
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 5 91 2.0E-21
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 5 91 2.0E-21
sp|P29447|THIO3_DICDI Thioredoxin-3 OS=Dictyostelium discoideum GN=trxC PE=3 SV=2 3 100 3.0E-21
sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 26 105 3.0E-21
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 13 91 4.0E-21
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 3 100 4.0E-21
sp|Q43636|TRXH_RICCO Thioredoxin H-type OS=Ricinus communis PE=3 SV=1 10 100 5.0E-21
sp|Q9TW67|NGLY1_CAEEL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=png-1 PE=1 SV=1 1 100 1.0E-20
sp|Q9C9Y6|TRXH9_ARATH Thioredoxin H9 OS=Arabidopsis thaliana GN=TRX9 PE=1 SV=1 2 100 2.0E-20
sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 10 93 2.0E-20
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 22 100 2.0E-20
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 13 91 3.0E-20
sp|P75512|THIO_MYCPN Thioredoxin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxA PE=3 SV=1 3 90 4.0E-20
sp|Q75GM1|TRXH5_ORYSJ Thioredoxin H5 OS=Oryza sativa subsp. japonica GN=Os05g0480200 PE=2 SV=1 12 99 5.0E-20
sp|Q86VQ3|TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens GN=TXNDC2 PE=2 SV=4 3 100 5.0E-20
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 3 85 9.0E-20
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 3 85 9.0E-20
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 1 91 1.0E-19
sp|P9WG67|THIO_MYCTU Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 5 91 1.0E-19
sp|P9WG66|THIO_MYCTO Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 5 91 1.0E-19
sp|P0A617|THIO_MYCBO Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 5 91 1.0E-19
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 3 82 1.0E-19
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 1 96 1.0E-19
sp|O94504|TRX2_SCHPO Thioredoxin-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx2 PE=1 SV=2 3 92 3.0E-19
sp|P29445|THIO1_DICDI Thioredoxin-1 OS=Dictyostelium discoideum GN=trxA PE=1 SV=1 3 100 3.0E-19
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 17 100 3.0E-19
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 17 100 4.0E-19
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 1 91 5.0E-19
sp|Q07090|TRXH2_TOBAC Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1 10 100 6.0E-19
sp|Q69AB1|TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus GN=Txndc8 PE=2 SV=1 3 94 6.0E-19
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 14 91 9.0E-19
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 5 91 1.0E-18
sp|P29446|THIO2_DICDI Thioredoxin-2 (Fragment) OS=Dictyostelium discoideum GN=trxB PE=2 SV=1 3 88 2.0E-18
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 10 91 2.0E-18
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 3 99 3.0E-18
sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein 8 OS=Mus musculus GN=Txndc8 PE=1 SV=1 3 94 3.0E-18
sp|Q9LXZ8|TRH10_ARATH Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 5 99 6.0E-18
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 25 100 7.0E-18
sp|Q9XIF4|TRXH7_ARATH Thioredoxin H7 OS=Arabidopsis thaliana GN=TRX7 PE=2 SV=1 3 100 7.0E-18
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 3 103 2.0E-17
sp|Q92JR5|THIO_RICCN Thioredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxA PE=3 SV=1 13 99 2.0E-17
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 12 91 2.0E-17
sp|Q68Y00|THIO_RICTY Thioredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxA PE=3 SV=1 3 99 2.0E-17
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 4 99 2.0E-17
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 15 91 2.0E-17
sp|Q9CAS1|TRXH8_ARATH Thioredoxin H8 OS=Arabidopsis thaliana GN=TRX8 PE=2 SV=1 3 104 2.0E-17
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 10 91 4.0E-17
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 5 100 4.0E-17
sp|P08058|THIO_RHOSH Thioredoxin OS=Rhodobacter sphaeroides GN=trxA PE=1 SV=3 1 91 5.0E-17
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 12 90 7.0E-17
sp|Q8LDI5|CXXS1_ARATH Thioredoxin-like protein CXXS1 OS=Arabidopsis thaliana GN=CXXS1 PE=2 SV=2 3 103 9.0E-17
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 15 103 1.0E-16
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 14 91 1.0E-16
sp|Q8KE49|THIO2_CHLTE Thioredoxin-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx2 PE=3 SV=3 14 91 1.0E-16
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 2 90 1.0E-16
sp|Q6P902|TXND2_MOUSE Thioredoxin domain-containing protein 2 OS=Mus musculus GN=Txndc2 PE=1 SV=1 3 101 1.0E-16
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 3 104 1.0E-16
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 22 100 2.0E-16
sp|Q54KN7|THIO5_DICDI Putative thioredoxin-5 OS=Dictyostelium discoideum GN=trxE PE=3 SV=1 19 100 2.0E-16
sp|Q8GXV2|CXXS2_ARATH Thioredoxin-like protein CXXS2 OS=Arabidopsis thaliana GN=CXXS2 PE=2 SV=1 10 99 3.0E-16
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 15 91 3.0E-16
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 8 91 3.0E-16
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 8 91 3.0E-16
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 8 91 3.0E-16
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 8 91 3.0E-16
sp|Q1RKN1|THIO_RICBR Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 13 99 3.0E-16
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 3 99 4.0E-16
sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 17 91 5.0E-16
sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 3 91 5.0E-16
sp|P80028|TRXH_CHLRE Thioredoxin H-type OS=Chlamydomonas reinhardtii GN=TRXH PE=1 SV=3 22 105 5.0E-16
sp|O48897|TRXF_BRANA Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1 22 91 6.0E-16
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 5 91 6.0E-16
sp|Q8LCH9|TRL33_ARATH Thioredoxin-like 3-3 OS=Arabidopsis thaliana GN=At3g53220 PE=2 SV=1 14 104 6.0E-16
sp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1 22 91 7.0E-16
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 1 90 1.0E-15
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 12 91 2.0E-15
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 1 81 2.0E-15
sp|Q5XHX6|TXND2_RAT Thioredoxin domain-containing protein 2 OS=Rattus norvegicus GN=Txndc2 PE=1 SV=2 6 91 2.0E-15
sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 3 91 2.0E-15
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 3 99 3.0E-15
sp|Q8CDN6|TXNL1_MOUSE Thioredoxin-like protein 1 OS=Mus musculus GN=Txnl1 PE=1 SV=3 14 100 3.0E-15
sp|Q9Z7P5|THIO_CHLPN Thioredoxin OS=Chlamydia pneumoniae GN=trxA PE=3 SV=1 3 101 3.0E-15
sp|Q920J4|TXNL1_RAT Thioredoxin-like protein 1 OS=Rattus norvegicus GN=Txnl1 PE=1 SV=3 14 100 3.0E-15
sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens GN=TXNL1 PE=1 SV=3 14 100 3.0E-15
sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1 15 103 3.0E-15
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 15 91 3.0E-15
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 14 83 3.0E-15
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 14 83 3.0E-15
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 14 83 3.0E-15
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 14 83 3.0E-15
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 14 83 3.0E-15
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 14 83 3.0E-15
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 3 103 3.0E-15
sp|P0A0K5|THIO_STAAW Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1 1 90 5.0E-15
sp|P0A0K6|THIO_STAAU Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1 1 90 5.0E-15
sp|Q6GA69|THIO_STAAS Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1 1 90 5.0E-15
sp|Q6GHU0|THIO_STAAR Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1 1 90 5.0E-15
sp|P99122|THIO_STAAN Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1 1 90 5.0E-15
sp|P0A0K4|THIO_STAAM Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=3 SV=1 1 90 5.0E-15
sp|Q5HGT9|THIO_STAAC Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1 1 90 5.0E-15
sp|Q2YXD0|THIO_STAAB Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1 1 90 5.0E-15
sp|Q2FZD2|THIO_STAA8 Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1 1 90 5.0E-15
sp|Q2FHT6|THIO_STAA3 Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1 1 90 5.0E-15
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 3 103 5.0E-15
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 17 101 7.0E-15
sp|Q7XSQ7|TRL33_ORYSJ Thioredoxin-like 3-3 OS=Oryza sativa subsp. japonica GN=Os04g0560200 PE=2 SV=2 8 104 8.0E-15
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 3 83 8.0E-15
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 24 101 8.0E-15
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 24 101 8.0E-15
sp|P29450|TRXF_PEA Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1 3 91 8.0E-15
sp|O48737|TRXM1_ARATH Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=2 SV=1 15 103 9.0E-15
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 15 91 9.0E-15
sp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2 22 91 9.0E-15
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 1 91 1.0E-14
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 14 91 1.0E-14
sp|Q9SEU8|TRXM2_ARATH Thioredoxin M2, chloroplastic OS=Arabidopsis thaliana GN=At4g03520 PE=1 SV=2 15 103 2.0E-14
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 7 91 2.0E-14
sp|Q8CPL5|THIO_STAES Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1 1 90 3.0E-14
sp|Q5HQ29|THIO_STAEQ Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1 1 90 3.0E-14
sp|Q6H7E4|TRXM1_ORYSJ Thioredoxin M1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0639900 PE=2 SV=1 3 91 3.0E-14
sp|Q4L5F0|THIO_STAHJ Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 1 90 3.0E-14
sp|P0A4L3|THIO_LISMO Thioredoxin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxA PE=3 SV=1 3 103 4.0E-14
sp|P0A4L4|THIO_LISIN Thioredoxin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxA PE=3 SV=1 3 103 4.0E-14
sp|P47938|THIO1_DROME Thioredoxin-1 OS=Drosophila melanogaster GN=dhd PE=1 SV=1 22 96 5.0E-14
sp|Q99757|THIOM_HUMAN Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2 1 90 5.0E-14
sp|Q5XJ54|GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio GN=glrx3 PE=2 SV=1 4 100 5.0E-14
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 15 92 7.0E-14
sp|P09856|TRXF_SPIOL Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 22 101 8.0E-14
sp|P97493|THIOM_MOUSE Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=1 SV=1 1 90 9.0E-14
sp|Q7XKD0|TRXX_ORYSJ Thioredoxin X, chloroplastic OS=Oryza sativa subsp. japonica GN=TRX-X PE=2 SV=1 14 85 1.0E-13
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 3 101 1.0E-13
sp|P97615|THIOM_RAT Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1 14 90 1.0E-13
sp|Q95108|THIOM_BOVIN Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2 14 90 1.0E-13
sp|Q5UR29|TR548_MIMIV Thioredoxin-like protein R548 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R548 PE=3 SV=1 2 100 1.0E-13
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 14 83 1.0E-13
sp|Q6A555|TXND8_HUMAN Thioredoxin domain-containing protein 8 OS=Homo sapiens GN=TXNDC8 PE=1 SV=2 6 94 2.0E-13
sp|P60226|THIO1_DROYA Thioredoxin-1 OS=Drosophila yakuba GN=dhd PE=2 SV=2 22 96 2.0E-13
sp|Q58DA7|GLRX3_BOVIN Glutaredoxin-3 OS=Bos taurus GN=GLRX3 PE=2 SV=1 8 100 2.0E-13
sp|Q1ZXE0|THIO4_DICDI Putative thioredoxin-4 OS=Dictyostelium discoideum GN=trxD PE=3 SV=2 3 98 2.0E-13
sp|Q8LD49|TRXX_ARATH Thioredoxin X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2 3 85 3.0E-13
sp|Q05739|THIO_STRC2 Thioredoxin OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxA PE=1 SV=1 14 91 3.0E-13
sp|O64764|TRXO1_ARATH Thioredoxin O1, mitochondrial OS=Arabidopsis thaliana GN=At2g35010 PE=2 SV=1 26 98 3.0E-13
sp|Q7XQQ2|TRXM3_ORYSJ Thioredoxin M3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0430800 PE=2 SV=4 6 90 4.0E-13
sp|Q49WR2|THIO_STAS1 Thioredoxin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trxA PE=3 SV=1 1 90 4.0E-13
sp|O76003|GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens GN=GLRX3 PE=1 SV=2 8 100 4.0E-13
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 2 91 9.0E-13
sp|O83889|THIO_TREPA Thioredoxin OS=Treponema pallidum (strain Nichols) GN=trxA PE=3 SV=1 1 90 1.0E-12
sp|Q9CQM9|GLRX3_MOUSE Glutaredoxin-3 OS=Mus musculus GN=Glrx3 PE=1 SV=1 8 100 1.0E-12
sp|Q9ZPH2|GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana GN=GRXS17 PE=1 SV=1 2 101 1.0E-12
sp|Q28ID3|GLRX3_XENTR Glutaredoxin-3 OS=Xenopus tropicalis GN=glrx3 PE=2 SV=2 3 100 1.0E-12
sp|Q9JLZ1|GLRX3_RAT Glutaredoxin-3 OS=Rattus norvegicus GN=Glrx3 PE=1 SV=2 8 100 2.0E-12
sp|P57653|THIO_BUCAI Thioredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxA PE=3 SV=1 3 98 3.0E-12
sp|Q655X0|TRXO_ORYSJ Thioredoxin O, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0665900 PE=2 SV=2 6 100 5.0E-12
sp|P96132|THIO_THIRO Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 14 83 6.0E-12
sp|O74790|GLRX4_SCHPO Monothiol glutaredoxin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx4 PE=1 SV=1 5 103 8.0E-12
sp|Q8LEK4|TRL21_ARATH Thioredoxin-like 2-1, chloroplastic OS=Arabidopsis thaliana GN=At4g26160 PE=2 SV=2 2 83 1.0E-11
sp|P32642|GLRX4_YEAST Monothiol glutaredoxin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX4 PE=1 SV=1 1 104 2.0E-11
sp|P52228|THIO3_CORNE Thioredoxin C-3 OS=Corynebacterium nephridii PE=3 SV=1 15 91 2.0E-11
sp|A2YUQ6|CITRX_ORYSI Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_29059 PE=3 SV=1 8 88 2.0E-11
sp|O51890|THIO_BUCAP Thioredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxA PE=3 SV=1 3 91 2.0E-11
sp|Q8H2V6|CITRX_ORYSJ Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0378900 PE=2 SV=1 8 88 3.0E-11
sp|Q93VQ9|TRXO2_ARATH Thioredoxin O2, mitochondrial OS=Arabidopsis thaliana GN=At1g31020 PE=2 SV=1 26 98 3.0E-11
sp|Q0J9V5|CXXS1_ORYSJ Thioredoxin-like protein CXXS1 OS=Oryza sativa subsp. japonica GN=Os04g0629500 PE=2 SV=1 22 92 3.0E-11
sp|P96611|YDBP_BACSU Thioredoxin-like protein YdbP OS=Bacillus subtilis (strain 168) GN=ydbP PE=2 SV=1 3 98 4.0E-11
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 6 86 5.0E-11
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 14 94 1.0E-10
sp|Q9SEU7|TRXM3_ARATH Thioredoxin M3, chloroplastic OS=Arabidopsis thaliana GN=GAT1 PE=2 SV=2 5 90 1.0E-10
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 6 85 1.0E-10
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 15 83 1.0E-10
sp|O51088|THIO_BORBU Thioredoxin OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxA PE=3 SV=1 24 83 2.0E-10
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 3 91 2.0E-10
sp|P09857|THIO_ALLVI Thioredoxin OS=Allochromatium vinosum GN=trxA PE=1 SV=1 2 83 2.0E-10
sp|O34357|YTPP_BACSU Thioredoxin-like protein YtpP OS=Bacillus subtilis (strain 168) GN=ytpP PE=2 SV=1 3 98 3.0E-10
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 3 91 4.0E-10
sp|Q86H62|GLRX3_DICDI Glutaredoxin-3 homolog OS=Dictyostelium discoideum GN=glrx3 PE=3 SV=1 6 104 4.0E-10
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 15 91 7.0E-10
sp|Q9M7X9|CITRX_ARATH Thioredoxin-like protein CITRX, chloroplastic OS=Arabidopsis thaliana GN=CITRX PE=1 SV=1 8 84 8.0E-10
sp|Q0IWL9|GRS11_ORYSJ Monothiol glutaredoxin-S11 OS=Oryza sativa subsp. japonica GN=GRXS11 PE=2 SV=2 24 100 1.0E-09
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 8 93 1.0E-09
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 6 93 1.0E-09
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 8 90 1.0E-09
sp|P81109|THIO_CLOSD Thioredoxin OS=Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654) GN=trxA PE=1 SV=2 14 92 1.0E-09
sp|P20857|THIO2_NOSS1 Thioredoxin-2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxB PE=1 SV=3 3 90 2.0E-09
sp|Q8LCT3|TRL22_ARATH Thioredoxin-like 2-2, chloroplastic OS=Arabidopsis thaliana GN=At4g29670 PE=2 SV=2 2 83 3.0E-09
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 6 82 3.0E-09
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 6 92 3.0E-09
sp|Q9LKW0|CITRX_SOLLC Thioredoxin-like protein CITRX, chloroplastic OS=Solanum lycopersicum GN=CITRX PE=1 SV=1 8 84 4.0E-09
sp|P73263|THIO2_SYNY3 Thioredoxin-like protein slr1139 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1139 PE=1 SV=1 1 91 5.0E-09
sp|Q6Z7L3|TRL31_ORYSJ Thioredoxin-like 3-1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0774100 PE=3 SV=2 5 96 5.0E-09
sp|M1A3D5|CITRX_SOLTU Thioredoxin-like protein CITRX, chloroplastic OS=Solanum tuberosum GN=CITRX PE=3 SV=1 8 84 5.0E-09
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 11 82 5.0E-09
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 15 84 6.0E-09
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 11 82 6.0E-09
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 11 82 6.0E-09
sp|Q03835|GLRX3_YEAST Monothiol glutaredoxin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX3 PE=1 SV=2 1 92 6.0E-09
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 3 91 8.0E-09
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 11 83 1.0E-08
sp|Q6JE37|CITX2_NICBE Thioredoxin-like protein CITRX2, chloroplastic OS=Nicotiana benthamiana GN=CITRX2 PE=1 SV=1 8 84 2.0E-08
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 11 82 2.0E-08
sp|Q39591|DYL4_CHLRE Dynein 14 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 3 90 2.0E-08
sp|O23166|TR164_ARATH Thioredoxin-like protein HCF164, chloroplastic OS=Arabidopsis thaliana GN=HCF164 PE=1 SV=2 8 105 2.0E-08
sp|Q6JE38|CITX1_NICBE Thioredoxin-like protein CITRX1, chloroplastic OS=Nicotiana benthamiana GN=CITRX1 PE=2 SV=1 8 84 2.0E-08
sp|Q5TKD8|TRL2_ORYSJ Thioredoxin-like 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0200100 PE=2 SV=1 2 83 3.0E-08
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 3 99 3.0E-08
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 3 96 3.0E-08
sp|Q9MAH1|TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana GN=TTL1 PE=1 SV=1 3 105 4.0E-08
sp|P21609|THIO_CLOLI Thioredoxin OS=Clostridium litorale GN=trxA PE=1 SV=2 14 92 4.0E-08
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 24 91 5.0E-08
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 24 90 5.0E-08
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 3 79 5.0E-08
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 3 79 6.0E-08
sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 4 82 6.0E-08
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 6 83 9.0E-08
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 3 96 9.0E-08
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 6 98 1.0E-07
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 8 86 1.0E-07
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 3 91 1.0E-07
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 11 82 2.0E-07
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 3 91 2.0E-07
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 3 90 2.0E-07
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 6 91 3.0E-07
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 11 82 3.0E-07
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 11 82 3.0E-07
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 10 93 3.0E-07
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 13 89 3.0E-07
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 24 91 4.0E-07
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 5 82 4.0E-07
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 3 96 4.0E-07
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 15 83 8.0E-07
sp|Q7Y0D4|TR164_ORYSJ Thioredoxin-like protein HCF164, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0767500 PE=2 SV=1 8 90 8.0E-07
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 3 83 1.0E-06
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 6 82 1.0E-06
sp|P21610|THIO_EUBAC Thioredoxin OS=Eubacterium acidaminophilum GN=trxA PE=1 SV=2 10 92 1.0E-06
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 15 92 2.0E-06
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 3 103 2.0E-06
sp|Q9C5C5|TRL4_ARATH Thioredoxin-like 4, chloroplastic OS=Arabidopsis thaliana GN=At1g07700 PE=2 SV=1 3 93 2.0E-06
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 6 83 2.0E-06
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 3 80 2.0E-06
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 1 82 3.0E-06
sp|Q6Z4N3|TRL11_ORYSJ Thioredoxin-like 1-1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os07g0684100 PE=2 SV=1 2 83 3.0E-06
sp|Q86XW9|TXND6_HUMAN Thioredoxin domain-containing protein 6 OS=Homo sapiens GN=NME9 PE=2 SV=1 6 100 3.0E-06
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 5 90 4.0E-06
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 2 82 4.0E-06
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 6 94 4.0E-06
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 3 90 4.0E-06
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 3 90 4.0E-06
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 18 84 4.0E-06
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 9 86 5.0E-06
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 3 90 5.0E-06
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 16 84 5.0E-06
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 12 95 5.0E-06
sp|O64654|TRL11_ARATH Thioredoxin-like 1-1, chloroplastic OS=Arabidopsis thaliana GN=At1g08570 PE=2 SV=1 2 83 6.0E-06
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 24 90 6.0E-06
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 24 90 6.0E-06
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 3 91 1.0E-05
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 3 91 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0045454 cell redox homeostasis Yes
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0042592 homeostatic process No
GO:0019725 cellular homeostasis No
GO:0065008 regulation of biological quality No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4530
MTVTEITSAEQFKEILSSNAKVAVDFTATWCGPCRVIGPVFHQLAEQFQDIVFVSVDVDKVVEVAKEYGIRAMPT
FFMFRDGQKVDDLTGADKVGLEEKINVFSA*
Coding >Hirsu2|4530
ATGACTGTCACGGAAATCACGTCGGCCGAGCAGTTCAAGGAGATACTAAGCAGCAATGCAAAGGTAGCCGTCGAC
TTCACGGCCACCTGGTGCGGGCCGTGCCGCGTCATCGGCCCCGTCTTCCATCAGCTGGCGGAGCAGTTCCAGGAC
ATCGTCTTCGTCTCGGTCGACGTGGACAAGGTGGTCGAGGTGGCGAAGGAGTACGGCATCCGCGCAATGCCGACC
TTTTTCATGTTCCGTGACGGGCAAAAGGTTGACGACCTGACGGGCGCCGATAAGGTGGGCCTCGAGGAGAAGATC
AACGTCTTTTCTGCCTAG
Transcript >Hirsu2|4530
ATGACTGTCACGGAAATCACGTCGGCCGAGCAGTTCAAGGAGATACTAAGCAGCAATGCAAAGGTAGCCGTCGAC
TTCACGGCCACCTGGTGCGGGCCGTGCCGCGTCATCGGCCCCGTCTTCCATCAGCTGGCGGAGCAGTTCCAGGAC
ATCGTCTTCGTCTCGGTCGACGTGGACAAGGTGGTCGAGGTGGCGAAGGAGTACGGCATCCGCGCAATGCCGACC
TTTTTCATGTTCCGTGACGGGCAAAAGGTTGACGACCTGACGGGCGCCGATAAGGTGGGCCTCGAGGAGAAGATC
AACGTCTTTTCTGCCTAG
Gene >Hirsu2|4530
ATGACTGTCACGGAAATCACGTCGGCCGAGCAGTTCAAGGAGATACTAAGCAGCAATGCAAAGGTAGCCGTCGAC
TTCACGGCCACCTGGTGCGGGCCGTGCCGCGTCATCGGCCCCGTCTTCCATCAGCTGGCGGAGCAGTTCCAGGAC
ATCGTCTTCGTCTCGGTCGACGTGGACAAGGTGGTCGAGGTGGCGAAGGAGTACGGCATCCGCGCAATGCCGACC
TTTTTCATGTTCCGTGACGGGCAAAAGGTTGACGACCTGACGGGCGCCGATAAGGTGGGCCTCGAGGAGAAGATC
AACGTCTTTTCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail