Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4527
Gene name
LocationContig_23:41566..43462
Strand-
Gene length (bp)1896
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.4901 0.2069 0.6534 0.2862 0.1862 0.178 0.1741 0.1746 0.3183 0.0181

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup842
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6267
Ophiocordyceps camponoti-floridani Ophcf2|05332
Ophiocordyceps camponoti-rufipedis Ophun1|5834
Ophiocordyceps kimflemingae Ophio5|1491
Ophiocordyceps kimflemingae Ophio5|4909
Ophiocordyceps subramaniannii Hirsu2|4527 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8822

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4527
MGQKDAKFFHWAILSSAERVAYQVADAFDASNGRQVTQGKTKIDNVPLEKGGQPPFLFQYKYNVKPSKAATLLAS
VSIGKAETSTQRLVDILKEVDIPCQDGESCVDWALGAIKALQHAGLVREFEVEKDFAPKTLEYGFQQFQRLLRDK
TRPADEVEEERTAVAEYGRDNNIILNSVKSKGKTNRLAEAQQAAKGAQQATTVAEATSQEKKAKNILRDAVGDGQ
AAIQAMSDDQRKKPSKADLDKIRKNLSETRKNFPDIRKAVAQASVAVAQKKADNVLEKLDKISKEAGPAGKDITS
QGEQEVQKINDVVKETQTLHDTASAKLSKIPAGKKGRMVGIDKDVQDLLQGPNILRLPASMETEADALKREAEAL
KKEVNVYKAGVEALQKKVQTATESLQKIKEAPSGNGEGGSDKDKAKDASGDKEESSDKNPGSKGQGSTEQDKQAA
QAKENAVKNANELQNGESSGSWLGKAAAGVAAAAGALGVSAFLAGVAGGSSAGAAGAGAGGLGAAFGGYAALESS
SALSVSAEETEALLAEQFDQIIIEAMEKAPLPPTTPPVAPAEPVPVPAVRRAVSSDMEPKALRRRASGDEKARRK
QLVDALKPELERLVKACLEEGIKRAVQRMAI*
Coding >Hirsu2|4527
ATGGGGCAAAAAGATGCCAAGTTCTTCCACTGGGCGATTCTAAGTAGCGCAGAACGTGTAGCTTATCAGGTTGCC
GACGCGTTTGACGCATCAAACGGCAGGCAAGTCACCCAGGGCAAGACCAAAATTGACAATGTGCCTTTGGAAAAG
GGGGGGCAGCCGCCATTCCTGTTCCAGTACAAGTACAACGTCAAGCCGTCCAAGGCTGCAACACTACTTGCATCG
GTCAGTATTGGCAAGGCAGAAACATCCACACAGCGGCTTGTGGACATTCTCAAGGAAGTGGATATACCATGTCAG
GATGGGGAAAGTTGCGTCGACTGGGCCTTGGGTGCCATAAAAGCGCTGCAACACGCCGGTCTTGTCCGGGAGTTT
GAAGTGGAGAAGGATTTTGCTCCAAAAACACTTGAATACGGTTTTCAGCAGTTCCAGCGCCTGCTCAGGGACAAG
ACAAGGCCGGCAGATGAAGTCGAAGAAGAAAGAACGGCGGTGGCCGAGTACGGTCGAGACAACAACATAATCCTG
AACTCGGTCAAAAGCAAAGGAAAGACAAACAGGTTGGCCGAGGCGCAGCAGGCGGCAAAAGGCGCCCAACAAGCA
ACAACTGTGGCCGAGGCTACGAGTCAGGAGAAGAAAGCCAAGAACATTCTCAGGGACGCCGTTGGGGATGGGCAA
GCTGCGATCCAGGCTATGAGCGACGATCAAAGGAAAAAACCATCCAAGGCAGACCTGGATAAGATTCGTAAGAAT
CTTTCCGAGACTCGTAAGAACTTCCCCGACATCAGAAAAGCCGTGGCCCAGGCCAGCGTGGCCGTCGCGCAAAAG
AAGGCCGATAATGTTCTGGAGAAGCTCGACAAGATCAGCAAAGAGGCTGGACCGGCCGGCAAGGATATTACATCG
CAAGGAGAGCAGGAGGTACAAAAAATCAACGACGTGGTCAAAGAGACTCAAACCCTCCACGACACTGCGTCTGCT
AAGCTTAGCAAAATTCCAGCCGGGAAGAAGGGACGAATGGTGGGTATAGACAAGGATGTTCAGGATCTTCTCCAG
GGCCCAAACATTCTTCGGCTGCCGGCGTCTATGGAGACCGAAGCAGACGCGCTGAAGCGGGAAGCCGAAGCACTG
AAAAAAGAGGTGAATGTCTACAAGGCGGGCGTCGAGGCGCTGCAGAAGAAGGTCCAGACGGCCACGGAATCTCTG
CAGAAGATCAAAGAAGCGCCCTCGGGAAATGGCGAGGGCGGAAGCGACAAAGATAAGGCCAAGGACGCAAGCGGC
GACAAAGAGGAATCAAGCGACAAGAACCCAGGCAGCAAGGGGCAGGGCAGCACAGAACAGGACAAGCAGGCCGCG
CAGGCCAAGGAGAATGCCGTGAAGAACGCCAATGAGCTGCAAAATGGCGAGAGCAGCGGCTCCTGGCTCGGCAAA
GCTGCCGCCGGCGTCGCTGCCGCAGCCGGCGCCCTCGGGGTCTCAGCTTTCCTGGCCGGCGTCGCCGGCGGGAGC
TCCGCAGGCGCCGCCGGCGCCGGCGCCGGGGGTCTCGGCGCCGCGTTCGGGGGCTATGCCGCGCTGGAGTCGTCG
TCCGCGCTGTCCGTCTCGGCCGAGGAGACGGAGGCTCTGCTCGCGGAACAATTCGACCAGATCATCATCGAGGCC
ATGGAGAAGGCACCACTACCGCCGACGACGCCCCCCGTAGCACCAGCTGAGCCGGTGCCTGTGCCTGCTGTCCGA
CGAGCCGTGTCAAGCGACATGGAGCCAAAAGCTTTGAGAAGACGGGCCTCTGGAGACGAAAAGGCGCGGCGAAAA
CAGCTGGTCGACGCCCTGAAGCCGGAACTGGAGCGACTCGTGAAAGCCTGTTTGGAAGAGGGGATAAAGAGAGCC
GTTCAGAGAATGGCAATATAA
Transcript >Hirsu2|4527
ATGGGGCAAAAAGATGCCAAGTTCTTCCACTGGGCGATTCTAAGTAGCGCAGAACGTGTAGCTTATCAGGTTGCC
GACGCGTTTGACGCATCAAACGGCAGGCAAGTCACCCAGGGCAAGACCAAAATTGACAATGTGCCTTTGGAAAAG
GGGGGGCAGCCGCCATTCCTGTTCCAGTACAAGTACAACGTCAAGCCGTCCAAGGCTGCAACACTACTTGCATCG
GTCAGTATTGGCAAGGCAGAAACATCCACACAGCGGCTTGTGGACATTCTCAAGGAAGTGGATATACCATGTCAG
GATGGGGAAAGTTGCGTCGACTGGGCCTTGGGTGCCATAAAAGCGCTGCAACACGCCGGTCTTGTCCGGGAGTTT
GAAGTGGAGAAGGATTTTGCTCCAAAAACACTTGAATACGGTTTTCAGCAGTTCCAGCGCCTGCTCAGGGACAAG
ACAAGGCCGGCAGATGAAGTCGAAGAAGAAAGAACGGCGGTGGCCGAGTACGGTCGAGACAACAACATAATCCTG
AACTCGGTCAAAAGCAAAGGAAAGACAAACAGGTTGGCCGAGGCGCAGCAGGCGGCAAAAGGCGCCCAACAAGCA
ACAACTGTGGCCGAGGCTACGAGTCAGGAGAAGAAAGCCAAGAACATTCTCAGGGACGCCGTTGGGGATGGGCAA
GCTGCGATCCAGGCTATGAGCGACGATCAAAGGAAAAAACCATCCAAGGCAGACCTGGATAAGATTCGTAAGAAT
CTTTCCGAGACTCGTAAGAACTTCCCCGACATCAGAAAAGCCGTGGCCCAGGCCAGCGTGGCCGTCGCGCAAAAG
AAGGCCGATAATGTTCTGGAGAAGCTCGACAAGATCAGCAAAGAGGCTGGACCGGCCGGCAAGGATATTACATCG
CAAGGAGAGCAGGAGGTACAAAAAATCAACGACGTGGTCAAAGAGACTCAAACCCTCCACGACACTGCGTCTGCT
AAGCTTAGCAAAATTCCAGCCGGGAAGAAGGGACGAATGGTGGGTATAGACAAGGATGTTCAGGATCTTCTCCAG
GGCCCAAACATTCTTCGGCTGCCGGCGTCTATGGAGACCGAAGCAGACGCGCTGAAGCGGGAAGCCGAAGCACTG
AAAAAAGAGGTGAATGTCTACAAGGCGGGCGTCGAGGCGCTGCAGAAGAAGGTCCAGACGGCCACGGAATCTCTG
CAGAAGATCAAAGAAGCGCCCTCGGGAAATGGCGAGGGCGGAAGCGACAAAGATAAGGCCAAGGACGCAAGCGGC
GACAAAGAGGAATCAAGCGACAAGAACCCAGGCAGCAAGGGGCAGGGCAGCACAGAACAGGACAAGCAGGCCGCG
CAGGCCAAGGAGAATGCCGTGAAGAACGCCAATGAGCTGCAAAATGGCGAGAGCAGCGGCTCCTGGCTCGGCAAA
GCTGCCGCCGGCGTCGCTGCCGCAGCCGGCGCCCTCGGGGTCTCAGCTTTCCTGGCCGGCGTCGCCGGCGGGAGC
TCCGCAGGCGCCGCCGGCGCCGGCGCCGGGGGTCTCGGCGCCGCGTTCGGGGGCTATGCCGCGCTGGAGTCGTCG
TCCGCGCTGTCCGTCTCGGCCGAGGAGACGGAGGCTCTGCTCGCGGAACAATTCGACCAGATCATCATCGAGGCC
ATGGAGAAGGCACCACTACCGCCGACGACGCCCCCCGTAGCACCAGCTGAGCCGGTGCCTGTGCCTGCTGTCCGA
CGAGCCGTGTCAAGCGACATGGAGCCAAAAGCTTTGAGAAGACGGGCCTCTGGAGACGAAAAGGCGCGGCGAAAA
CAGCTGGTCGACGCCCTGAAGCCGGAACTGGAGCGACTCGTGAAAGCCTGTTTGGAAGAGGGGATAAAGAGAGCC
GTTCAGAGAATGGCAATATAA
Gene >Hirsu2|4527
ATGGGGCAAAAAGATGCCAAGTTCTTCCACTGGGCGATTCTAAGTAGCGCAGAACGTGTAGCTTATCAGGTTGCC
GACGCGTTTGACGCATCAAACGGCAGGCAAGTCACCCAGGGCAAGACCAAAATTGACAATGTGCCTTTGGAAAAG
GGGGGGCAGCCGCCATTCCTGTTCCAGTACAAGTACAACGTCAAGCCGTCCAAGGCTGCAACACTACTTGCATCG
GTCAGTATTGGCAAGGCAGAAACATCCACACAGCGGCTTGTGGACATTCTCAAGGAAGTGGATATACCATGTCAG
GATGGGGAAAGTTGCGTCGACTGGGCCTTGGGTGCCATAAAAGCGCTGCAACACGCCGGTCTTGTCCGGGAGTTT
GAAGTGGAGAAGGATTTTGCTCCAAAAACACTTGAATACGGTTTTCAGCAGTTCCAGCGCCTGCTCAGGGACAAG
ACAAGGCCGGCAGATGAAGTCGAAGAAGAAAGAACGGCGGTGGCCGAGTACGGTCGAGACAACAACATAATCCTG
AACTCGGTCAAAAGCAAAGGAAAGACAAACAGGTTGGCCGAGGCGCAGCAGGCGGCAAAAGGCGCCCAACAAGCA
ACAACTGTGGCCGAGGCTACGAGTCAGGAGAAGAAAGCCAAGAACATTCTCAGGGACGCCGTTGGGGATGGGCAA
GCTGCGATCCAGGCTATGAGCGACGATCAAAGGAAAAAACCATCCAAGGCAGACCTGGATAAGATTCGTAAGAAT
CTTTCCGAGACTCGTAAGAACTTCCCCGACATCAGAAAAGCCGTGGCCCAGGCCAGCGTGGCCGTCGCGCAAAAG
AAGGCCGATAATGTTCTGGAGAAGCTCGACAAGATCAGCAAAGAGGCTGGACCGGCCGGCAAGGATATTACATCG
CAAGGAGAGCAGGAGGTACAAAAAATCAACGACGTGGTCAAAGAGACTCAAACCCTCCACGACACTGCGTCTGCT
AAGCTTAGCAAAATTCCAGCCGGGAAGAAGGGACGAATGGTGGGTATAGACAAGGATGTTCAGGATCTTCTCCAG
GGCCCAAACATTCTTCGGCTGCCGGCGTCTATGGAGACCGAAGCAGACGCGCTGAAGCGGGAAGCCGAAGCACTG
AAAAAAGAGGTGAATGTCTACAAGGCGGGCGTCGAGGCGCTGCAGAAGAAGGTCCAGACGGCCACGGAATCTCTG
CAGAAGATCAAAGAAGCGCCCTCGGGAAATGGCGAGGGCGGAAGCGACAAAGATAAGGCCAAGGACGCAAGCGGC
GACAAAGAGGAATCAAGCGACAAGAACCCAGGCAGCAAGGGGCAGGGCAGCACAGAACAGGACAAGCAGGCCGCG
CAGGCCAAGGAGAATGCCGTGAAGAACGCCAATGAGCTGCAAAATGGCGAGAGCAGCGGCTCCTGGCTCGGCAAA
GCTGCCGCCGGCGTCGCTGCCGCAGCCGGCGCCCTCGGGGTCTCAGCTTTCCTGGCCGGCGTCGCCGGCGGGAGC
TCCGCAGGCGCCGCCGGCGCCGGCGCCGGGGGTCTCGGCGCCGCGTTCGGGGGCTATGCCGCGCTGGAGTCGTCG
TCCGCGCTGTCCGTCTCGGCCGAGGAGACGGAGGCTCTGCTCGCGGAACAATTCGACCAGATCATCATCGAGGCC
ATGGAGAAGGCACCACTACCGCCGACGACGCCCCCCGTAGCACCAGCTGAGCCGGTGCCTGTGCCTGCTGTCCGA
CGAGCCGTGTCAAGCGACATGGAGCCAAAAGCTTTGAGAAGACGGGCCTCTGGAGACGAAAAGGCGCGGCGAAAA
CAGCTGGTCGACGCCCTGAAGCCGGAACTGGAGCGACTCGTGAAAGCCTGTTTGGAAGAGGGGATAAAGAGAGCC
GTTCAGAGAATGGCAATATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail