Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4522
Gene name
LocationContig_23:25005..30420
Strand-
Gene length (bp)5415
Transcript length (bp)5268
Coding sequence length (bp)5268
Protein length (aa) 1756

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04997 RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1 3.0E-107 14 355
PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5 8.3E-100 821 1418
PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2 3.9E-76 357 522
PF04992 RNA_pol_Rpb1_6 RNA polymerase Rpb1, domain 6 3.3E-58 887 1071
PF04990 RNA_pol_Rpb1_7 RNA polymerase Rpb1, domain 7 1.4E-45 1155 1290
PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3 2.1E-44 525 683
PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4 1.7E-36 710 814

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 1 1607 0.0E+00
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 6 1592 0.0E+00
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 8 1619 0.0E+00
sp|P18616|NRPB1_ARATH DNA-directed RNA polymerase II subunit 1 OS=Arabidopsis thaliana GN=NRPB1 PE=1 SV=3 6 1750 0.0E+00
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 7 1752 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 1 1607 0.0E+00
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 6 1592 0.0E+00
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 8 1619 0.0E+00
sp|P18616|NRPB1_ARATH DNA-directed RNA polymerase II subunit 1 OS=Arabidopsis thaliana GN=NRPB1 PE=1 SV=3 6 1750 0.0E+00
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 7 1752 0.0E+00
sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum GN=polr2a PE=2 SV=2 5 1588 0.0E+00
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 11 1644 0.0E+00
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 11 1645 0.0E+00
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 9 1619 0.0E+00
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 9 1619 0.0E+00
sp|Q8SSC4|RPB1_ENCCU DNA-directed RNA polymerase II subunit RPB1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB1 PE=3 SV=1 14 1476 0.0E+00
sp|P17545|RPB1B_TRYBB DNA-directed RNA polymerase II subunit RPB1-B OS=Trypanosoma brucei brucei GN=TRP5.9 PE=1 SV=1 9 1740 0.0E+00
sp|P17546|RPB1A_TRYBB DNA-directed RNA polymerase II subunit RPB1-A OS=Trypanosoma brucei brucei GN=TRP4.8 PE=1 SV=1 9 1740 0.0E+00
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 722 1580 0.0E+00
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 6 577 0.0E+00
sp|Q7T6X5|RPO1_MIMIV DNA-directed RNA polymerase subunit 1 OS=Acanthamoeba polyphaga mimivirus GN=RPO1 PE=1 SV=2 13 1491 0.0E+00
sp|O94666|RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc1 PE=2 SV=1 14 1466 0.0E+00
sp|Q6BI69|RPC1_DEBHA DNA-directed RNA polymerase III subunit RPC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPC1 PE=3 SV=2 14 1473 0.0E+00
sp|P04051|RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO31 PE=1 SV=1 14 1466 0.0E+00
sp|P31813|RPOA1_THECE DNA-directed RNA polymerase subunit A' OS=Thermococcus celer GN=rpoA1 PE=3 SV=1 14 890 0.0E+00
sp|P11512|RPOA1_SULAC DNA-directed RNA polymerase subunit A' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA1 PE=3 SV=2 14 890 0.0E+00
sp|O27125|RPOA1_METTH DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA1 PE=3 SV=1 13 888 0.0E+00
sp|Q980R2|RPOA1_SULSO DNA-directed RNA polymerase subunit A' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA1 PE=1 SV=1 14 890 0.0E+00
sp|P0CX02|RPOA1_HALSA DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoA1 PE=3 SV=1 14 886 0.0E+00
sp|B0R8D4|RPOA1_HALS3 DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoA1 PE=1 SV=1 14 886 0.0E+00
sp|P41556|RPOA1_METVS DNA-directed RNA polymerase subunit A' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA1 PE=3 SV=1 14 888 0.0E+00
sp|P09846|RPOA1_METTW DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA1 PE=3 SV=2 13 888 0.0E+00
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 14 888 0.0E+00
sp|Q03585|RPOA1_THEAC DNA-directed RNA polymerase subunit A' OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoA1 PE=3 SV=1 14 888 0.0E+00
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 14 893 0.0E+00
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 14 893 0.0E+00
sp|Q5ZL98|RPC1_CHICK DNA-directed RNA polymerase III subunit RPC1 OS=Gallus gallus GN=POLR3A PE=2 SV=1 14 893 5.0E-180
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 2 597 6.0E-172
sp|F4JXF9|NRPC1_ARATH DNA-directed RNA polymerase III subunit 1 OS=Arabidopsis thaliana GN=NRPC1 PE=2 SV=1 6 893 7.0E-166
sp|P28364|RPB1_EUPOC DNA-directed RNA polymerase II subunit RPB1 (Fragment) OS=Euplotes octocarinatus GN=RPB1 PE=3 SV=1 6 499 3.0E-147
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 243 893 7.0E-143
sp|P42486|RPB1_ASFB7 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-99 PE=3 SV=1 16 1472 6.0E-141
sp|P0C989|RPB1_ASFK5 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-111 PE=3 SV=1 16 1472 6.0E-141
sp|Q65215|RPB1_ASFM2 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-107 PE=3 SV=2 16 1472 9.0E-141
sp|P0C988|RPB1_ASFWA Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-109 PE=3 SV=1 16 1472 1.0E-140
sp|P0C987|RPB1_ASFP4 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-111 PE=3 SV=1 16 1472 1.0E-140
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 311 1166 1.0E-127
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 311 1168 2.0E-127
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 311 1180 1.0E-124
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 431 1469 2.0E-120
sp|Q196X0|RPB1_IIV3 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-090L PE=3 SV=1 16 888 3.0E-117
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 246 888 1.0E-116
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 14 500 7.0E-110
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 311 888 7.0E-105
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 423 888 2.0E-102
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 307 888 1.0E-100
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 241 896 2.0E-100
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 14 889 2.0E-99
sp|Q6GZW7|RPB1_FRG3G Putative DNA-directed RNA polymerase 008R OS=Frog virus 3 (isolate Goorha) GN=FV3-008R PE=3 SV=1 16 888 1.0E-98
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 614 986 5.0E-90
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1242 1753 8.0E-85
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 492 896 1.0E-84
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 242 888 9.0E-84
sp|O55766|RPB1_IIV6 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-176R PE=3 SV=1 439 888 1.0E-79
sp|P15349|RPOA1_HALMO DNA-directed RNA polymerase subunit A' (Fragment) OS=Halococcus morrhuae GN=rpoA1 PE=3 SV=1 619 885 1.0E-66
sp|A4J104|RPOC_DESRM DNA-directed RNA polymerase subunit beta' OS=Desulfotomaculum reducens (strain MI-1) GN=rpoC PE=3 SV=1 13 867 4.0E-62
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 17 867 4.0E-61
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 17 867 8.0E-61
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 13 865 2.0E-60
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 13 865 3.0E-60
sp|Q2S906|RPOC_HAHCH DNA-directed RNA polymerase subunit beta' OS=Hahella chejuensis (strain KCTC 2396) GN=rpoC PE=3 SV=1 17 862 5.0E-60
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 13 874 8.0E-60
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 13 874 8.0E-60
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 13 874 8.0E-60
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 17 865 3.0E-59
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 13 865 4.0E-59
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 13 867 5.0E-59
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 13 865 7.0E-59
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 13 865 1.0E-58
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 19 865 2.0E-58
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 19 874 3.0E-58
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 19 874 3.0E-58
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 13 865 4.0E-58
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 19 874 6.0E-58
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 19 874 6.0E-58
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 19 874 6.0E-58
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 19 874 6.0E-58
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 13 865 6.0E-58
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 19 874 6.0E-58
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 19 874 7.0E-58
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 19 874 7.0E-58
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 13 867 7.0E-58
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 13 867 7.0E-58
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 19 874 8.0E-58
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 13 867 9.0E-58
sp|A9KJL3|RPOC_CLOPH DNA-directed RNA polymerase subunit beta' OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpoC PE=3 SV=1 15 865 1.0E-57
sp|Q3ILP8|RPOC_PSEHT DNA-directed RNA polymerase subunit beta' OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpoC PE=3 SV=1 4 867 1.0E-57
sp|A4VHM4|RPOC_PSEU5 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas stutzeri (strain A1501) GN=rpoC PE=3 SV=1 4 862 1.0E-57
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 13 867 1.0E-57
sp|Q7VRP8|RPOC_BLOFL DNA-directed RNA polymerase subunit beta' OS=Blochmannia floridanus GN=rpoC PE=3 SV=1 1 886 2.0E-57
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 13 867 3.0E-57
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 19 874 3.0E-57
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 16 422 4.0E-57
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 19 874 4.0E-57
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 19 874 4.0E-57
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 19 867 5.0E-57
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 19 874 6.0E-57
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 19 874 6.0E-57
sp|Q9HWC9|RPOC_PSEAE DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpoC PE=3 SV=1 4 862 6.0E-57
sp|Q02T86|RPOC_PSEAB DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpoC PE=3 SV=1 4 862 6.0E-57
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 19 874 7.0E-57
sp|O93777|RPOA2_PYRHO DNA-directed RNA polymerase subunit A'' OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoA2 PE=3 SV=1 1048 1461 7.0E-57
sp|A4XZ96|RPOC_PSEMY DNA-directed RNA polymerase subunit beta' OS=Pseudomonas mendocina (strain ymp) GN=rpoC PE=3 SV=1 4 862 8.0E-57
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 19 867 8.0E-57
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 19 867 8.0E-57
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 19 867 8.0E-57
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 13 865 8.0E-57
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 19 874 9.0E-57
sp|A6UZI2|RPOC_PSEA7 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain PA7) GN=rpoC PE=3 SV=1 4 862 1.0E-56
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 17 867 1.0E-56
sp|A9KW96|RPOC_SHEB9 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS195) GN=rpoC PE=3 SV=1 4 862 1.0E-56
sp|A6WHS2|RPOC_SHEB8 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS185) GN=rpoC PE=3 SV=1 4 862 1.0E-56
sp|B8EBL1|RPOC_SHEB2 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS223) GN=rpoC PE=3 SV=1 4 862 1.0E-56
sp|C3N7Q1|RPOA2_SULIY DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpoA2 PE=3 SV=1 1048 1469 1.0E-56
sp|C3NFS2|RPOA2_SULIN DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpoA2 PE=3 SV=1 1048 1469 1.0E-56
sp|C3MYA0|RPOA2_SULIM DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoA2 PE=3 SV=1 1048 1469 1.0E-56
sp|C3MRK4|RPOA2_SULIL DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpoA2 PE=3 SV=1 1048 1469 1.0E-56
sp|C4KIV9|RPOA2_SULIK DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoA2 PE=3 SV=1 1048 1469 1.0E-56
sp|C3MZM9|RPOA2_SULIA DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.16.27) GN=rpoA2 PE=3 SV=1 1048 1469 1.0E-56
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 19 867 2.0E-56
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 19 874 2.0E-56
sp|P58192|RPOA2_SULSO DNA-directed RNA polymerase subunit A'' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA2 PE=1 SV=1 1037 1469 2.0E-56
sp|P14247|RPOA2_METVS DNA-directed RNA polymerase subunit A'' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA2 PE=3 SV=2 1036 1467 2.0E-56
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 19 865 2.0E-56
sp|A8GYX0|RPOC_SHEPA DNA-directed RNA polymerase subunit beta' OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpoC PE=3 SV=1 4 862 2.0E-56
sp|Q6FF89|RPOC_ACIAD DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpoC PE=3 SV=2 17 862 2.0E-56
sp|Q88QP1|RPOC_PSEPK DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain KT2440) GN=rpoC PE=3 SV=1 4 862 3.0E-56
sp|A4W5A8|RPOC_ENT38 DNA-directed RNA polymerase subunit beta' OS=Enterobacter sp. (strain 638) GN=rpoC PE=3 SV=1 4 867 3.0E-56
sp|A5VXP1|RPOC_PSEP1 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpoC PE=3 SV=1 4 862 3.0E-56
sp|Q058E6|RPOC_BUCCC DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpoC PE=3 SV=1 14 881 4.0E-56
sp|B2UYA4|RPOC_CLOBA DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpoC PE=3 SV=1 13 865 4.0E-56
sp|Q4ZMN8|RPOC_PSEU2 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpoC PE=3 SV=1 4 862 4.0E-56
sp|Q0SY12|RPOC_SHIF8 DNA-directed RNA polymerase subunit beta' OS=Shigella flexneri serotype 5b (strain 8401) GN=rpoC PE=3 SV=1 4 867 4.0E-56
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 17 875 4.0E-56
sp|Q889X7|RPOC_PSESM DNA-directed RNA polymerase subunit beta' OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpoC PE=3 SV=1 4 862 5.0E-56
sp|Q48D30|RPOC_PSE14 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpoC PE=3 SV=1 4 862 5.0E-56
sp|A6TGP1|RPOC_KLEP7 DNA-directed RNA polymerase subunit beta' OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpoC PE=3 SV=1 4 867 5.0E-56
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 17 879 5.0E-56
sp|P57145|RPOC_BUCAI DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpoC PE=3 SV=1 4 867 5.0E-56
sp|B2TIG9|RPOC_CLOBB DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpoC PE=3 SV=1 13 865 5.0E-56
sp|B2UQY1|RPOC_AKKM8 DNA-directed RNA polymerase subunit beta' OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpoC PE=3 SV=1 14 862 5.0E-56
sp|A1JII1|RPOC_YERE8 DNA-directed RNA polymerase subunit beta' OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpoC PE=3 SV=1 4 867 6.0E-56
sp|Q8D232|RPOC_WIGBR DNA-directed RNA polymerase subunit beta' OS=Wigglesworthia glossinidia brevipalpis GN=rpoC PE=3 SV=1 4 867 6.0E-56
sp|A1S212|RPOC_SHEAM DNA-directed RNA polymerase subunit beta' OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpoC PE=3 SV=1 4 862 7.0E-56
sp|Q8EK73|RPOC_SHEON DNA-directed RNA polymerase subunit beta' OS=Shewanella oneidensis (strain MR-1) GN=rpoC PE=3 SV=1 4 862 7.0E-56
sp|Q47UW0|RPOC_COLP3 DNA-directed RNA polymerase subunit beta' OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpoC PE=3 SV=1 4 879 8.0E-56
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 13 865 8.0E-56
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 19 874 9.0E-56
sp|A1REA8|RPOC_SHESW DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain W3-18-1) GN=rpoC PE=3 SV=1 4 862 9.0E-56
sp|A4YBY9|RPOC_SHEPC DNA-directed RNA polymerase subunit beta' OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpoC PE=3 SV=1 4 862 9.0E-56
sp|Q32AG0|RPOC_SHIDS DNA-directed RNA polymerase subunit beta' OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|B2TWH4|RPOC_SHIB3 DNA-directed RNA polymerase subunit beta' OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|Q0HNU3|RPOC_SHESM DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain MR-4) GN=rpoC PE=3 SV=1 4 862 1.0E-55
sp|Q3YUZ6|RPOC_SHISS DNA-directed RNA polymerase subunit beta' OS=Shigella sonnei (strain Ss046) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|P0A8T9|RPOC_SHIFL DNA-directed RNA polymerase subunit beta' OS=Shigella flexneri GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|Q31U09|RPOC_SHIBS DNA-directed RNA polymerase subunit beta' OS=Shigella boydii serotype 4 (strain Sb227) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|P0A8T7|RPOC_ECOLI DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain K12) GN=rpoC PE=1 SV=1 4 867 1.0E-55
sp|B1IUQ9|RPOC_ECOLC DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|A8A787|RPOC_ECOHS DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O9:H4 (strain HS) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|B1XBZ0|RPOC_ECODH DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain K12 / DH10B) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|P0A8T8|RPOC_ECO57 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O157:H7 GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|A7ZUK2|RPOC_ECO24 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpoC PE=1 SV=1 4 867 1.0E-55
sp|A0KRL8|RPOC_SHESA DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain ANA-3) GN=rpoC PE=3 SV=1 4 862 1.0E-55
sp|B0KK61|RPOC_PSEPG DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain GB-1) GN=rpoC PE=3 SV=1 4 862 1.0E-55
sp|Q0I0B1|RPOC_SHESR DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain MR-7) GN=rpoC PE=3 SV=1 4 862 1.0E-55
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 17 875 1.0E-55
sp|B8CNC6|RPOC_SHEPW DNA-directed RNA polymerase subunit beta' OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpoC PE=3 SV=1 4 862 1.0E-55
sp|Q0TA77|RPOC_ECOL5 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|A8G1F4|RPOC_SHESH DNA-directed RNA polymerase subunit beta' OS=Shewanella sediminis (strain HAW-EB3) GN=rpoC PE=3 SV=1 4 862 1.0E-55
sp|Q1R5V4|RPOC_ECOUT DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain UTI89 / UPEC) GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|A1AIG0|RPOC_ECOK1 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O1:K1 / APEC GN=rpoC PE=3 SV=1 4 867 1.0E-55
sp|B1LNU0|RPOC_ECOSM DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpoC PE=3 SV=1 4 867 2.0E-55
sp|Q089R0|RPOC_SHEFN DNA-directed RNA polymerase subunit beta' OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpoC PE=3 SV=1 4 862 2.0E-55
sp|Q65W40|RPOC_MANSM DNA-directed RNA polymerase subunit beta' OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpoC PE=3 SV=2 19 862 2.0E-55
sp|A4FWF5|RPOA2_METM5 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpoA2 PE=3 SV=1 1036 1468 2.0E-55
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 17 867 2.0E-55
sp|B1JJK0|RPOC_YERPY DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpoC PE=3 SV=1 4 867 2.0E-55
sp|Q66FQ1|RPOC_YERPS DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpoC PE=3 SV=1 4 867 2.0E-55
sp|A4TS28|RPOC_YERPP DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis (strain Pestoides F) GN=rpoC PE=3 SV=2 4 867 2.0E-55
sp|Q1CN77|RPOC_YERPN DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpoC PE=3 SV=2 4 867 2.0E-55
sp|A9R0H9|RPOC_YERPG DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpoC PE=3 SV=1 4 867 2.0E-55
sp|Q8D1H3|RPOC_YERPE DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis GN=rpoC PE=3 SV=2 4 867 2.0E-55
sp|B2K114|RPOC_YERPB DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpoC PE=3 SV=1 4 867 2.0E-55
sp|Q1C1U2|RPOC_YERPA DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpoC PE=3 SV=2 4 867 2.0E-55
sp|A7FNI2|RPOC_YERP3 DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpoC PE=3 SV=1 4 867 2.0E-55
sp|Q8FB83|RPOC_ECOL6 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpoC PE=3 SV=1 4 867 2.0E-55
sp|B2SFD7|RPOC_FRATM DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpoC PE=3 SV=1 8 862 2.0E-55
sp|Q12SW5|RPOC_SHEDO DNA-directed RNA polymerase subunit beta' OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpoC PE=3 SV=1 4 862 2.0E-55
sp|A9N0J5|RPOC_SALPB DNA-directed RNA polymerase subunit beta' OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpoC PE=3 SV=1 4 867 3.0E-55
sp|B0TM18|RPOC_SHEHH DNA-directed RNA polymerase subunit beta' OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpoC PE=3 SV=1 4 862 3.0E-55
sp|B1JDX0|RPOC_PSEPW DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain W619) GN=rpoC PE=3 SV=1 4 862 3.0E-55
sp|Q1IFX2|RPOC_PSEE4 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas entomophila (strain L48) GN=rpoC PE=3 SV=1 4 862 3.0E-55
sp|A6VGV0|RPOA2_METM7 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpoA2 PE=3 SV=1 1036 1470 3.0E-55
sp|A4IWA0|RPOC_FRATW DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpoC PE=3 SV=1 8 862 3.0E-55
sp|Q5NID1|RPOC_FRATT DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpoC PE=3 SV=1 8 862 3.0E-55
sp|Q14JT4|RPOC_FRAT1 DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpoC PE=3 SV=1 8 862 3.0E-55
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 19 874 3.0E-55
sp|B5YFV7|RPOC_THEYD DNA-directed RNA polymerase subunit beta' OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpoC PE=3 SV=1 19 862 3.0E-55
sp|Q0BKC6|RPOC_FRATO DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpoC PE=3 SV=1 8 862 3.0E-55
sp|Q2A1M8|RPOC_FRATH DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpoC PE=3 SV=1 8 862 3.0E-55
sp|Q15YB0|RPOC_PSEA6 DNA-directed RNA polymerase subunit beta' OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpoC PE=3 SV=1 4 862 3.0E-55
sp|B3EL62|RPOC_CHLPB DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain BS1) GN=rpoC PE=3 SV=1 4 871 3.0E-55
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 19 874 4.0E-55
sp|A0Q866|RPOC_FRATN DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. novicida (strain U112) GN=rpoC PE=3 SV=1 8 862 4.0E-55
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 19 874 4.0E-55
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 19 867 4.0E-55
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 19 867 4.0E-55
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 19 874 4.0E-55
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 19 874 4.0E-55
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 19 874 4.0E-55
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 19 874 4.0E-55
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 19 874 4.0E-55
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 19 874 4.0E-55
sp|A8G8E8|RPOC_SERP5 DNA-directed RNA polymerase subunit beta' OS=Serratia proteamaculans (strain 568) GN=rpoC PE=3 SV=1 4 867 4.0E-55
sp|A9A9U9|RPOA2_METM6 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpoA2 PE=3 SV=1 1036 1468 4.0E-55
sp|C3K2Y2|RPOC_PSEFS DNA-directed RNA polymerase subunit beta' OS=Pseudomonas fluorescens (strain SBW25) GN=rpoC PE=3 SV=1 4 862 5.0E-55
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 17 865 5.0E-55
sp|P0A2R4|RPOC_SALTY DNA-directed RNA polymerase subunit beta' OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpoC PE=3 SV=1 4 867 5.0E-55
sp|P0A2R5|RPOC_SALTI DNA-directed RNA polymerase subunit beta' OS=Salmonella typhi GN=rpoC PE=3 SV=1 4 867 5.0E-55
sp|Q57H68|RPOC_SALCH DNA-directed RNA polymerase subunit beta' OS=Salmonella choleraesuis (strain SC-B67) GN=rpoC PE=3 SV=1 4 867 5.0E-55
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 17 867 6.0E-55
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 17 867 6.0E-55
sp|Q89B21|RPOC_BUCBP DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpoC PE=3 SV=1 19 867 6.0E-55
sp|Q5PK92|RPOC_SALPA DNA-directed RNA polymerase subunit beta' OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpoC PE=3 SV=1 4 867 6.0E-55
sp|Q6LXI7|RPOA2_METMP DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain S2 / LL) GN=rpoA2 PE=3 SV=1 1036 1468 7.0E-55
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 19 867 8.0E-55
sp|Q4K527|RPOC_PSEF5 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpoC PE=3 SV=1 4 862 8.0E-55
sp|A4YCR0|RPOA2_METS5 DNA-directed RNA polymerase subunit A'' OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpoA2 PE=3 SV=1 1052 1469 8.0E-55
sp|A9MHE9|RPOC_SALAR DNA-directed RNA polymerase subunit beta' OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpoC PE=3 SV=1 4 867 9.0E-55
sp|A8AKT8|RPOC_CITK8 DNA-directed RNA polymerase subunit beta' OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpoC PE=3 SV=1 4 867 9.0E-55
sp|Q2NWR5|RPOC_SODGM DNA-directed RNA polymerase subunit beta' OS=Sodalis glossinidius (strain morsitans) GN=rpoC PE=3 SV=1 4 867 1.0E-54
sp|Q01VB2|RPOC_SOLUE DNA-directed RNA polymerase subunit beta' OS=Solibacter usitatus (strain Ellin6076) GN=rpoC PE=3 SV=1 17 862 1.0E-54
sp|Q3K5Y2|RPOC_PSEPF DNA-directed RNA polymerase subunit beta' OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpoC PE=3 SV=1 4 862 1.0E-54
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 17 867 1.0E-54
sp|Q74L94|RPOC_LACJO DNA-directed RNA polymerase subunit beta' OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoC PE=3 SV=1 17 865 1.0E-54
sp|Q6DAM9|RPOC_PECAS DNA-directed RNA polymerase subunit beta' OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpoC PE=3 SV=1 4 867 1.0E-54
sp|Q9KW13|RPOC_SHEVI DNA-directed RNA polymerase subunit beta' OS=Shewanella violacea GN=rpoC PE=3 SV=1 4 862 1.0E-54
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 14 867 1.0E-54
sp|A5EX69|RPOC_DICNV DNA-directed RNA polymerase subunit beta' OS=Dichelobacter nodosus (strain VCS1703A) GN=rpoC PE=3 SV=1 1 862 1.0E-54
sp|Q0ABI1|RPOC_ALKEH DNA-directed RNA polymerase subunit beta' OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpoC PE=3 SV=1 6 862 1.0E-54
sp|B0SUP8|RPOC_CAUSK DNA-directed RNA polymerase subunit beta' OS=Caulobacter sp. (strain K31) GN=rpoC PE=3 SV=1 3 861 1.0E-54
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 13 865 1.0E-54
sp|Q5QWA4|RPOC_IDILO DNA-directed RNA polymerase subunit beta' OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpoC PE=3 SV=1 19 879 2.0E-54
sp|B3E164|RPOC_METI4 DNA-directed RNA polymerase subunit beta' OS=Methylacidiphilum infernorum (isolate V4) GN=rpoC PE=3 SV=1 17 885 2.0E-54
sp|Q5D869|NRPE1_ARATH DNA-directed RNA polymerase V subunit 1 OS=Arabidopsis thaliana GN=NRPE1 PE=1 SV=1 19 970 2.0E-54
sp|B2VG97|RPOC_ERWT9 DNA-directed RNA polymerase subunit beta' OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpoC PE=3 SV=1 4 867 2.0E-54
sp|B1KMY9|RPOC_SHEWM DNA-directed RNA polymerase subunit beta' OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpoC PE=3 SV=1 4 862 2.0E-54
sp|Q046D1|RPOC_LACGA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoC PE=3 SV=1 17 865 3.0E-54
sp|A3PGJ0|RPOC_RHOS1 DNA-directed RNA polymerase subunit beta' OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpoC1 PE=3 SV=1 11 874 4.0E-54
sp|A4WVL5|RPOC_RHOS5 DNA-directed RNA polymerase subunit beta' OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpoC PE=3 SV=1 11 874 4.0E-54
sp|Q3J5S9|RPOC_RHOS4 DNA-directed RNA polymerase subunit beta' OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpoC PE=3 SV=1 11 874 4.0E-54
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 992 1255 5.0E-54
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 17 867 6.0E-54
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 13 865 6.0E-54
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 17 867 7.0E-54
sp|A1BD24|RPOC_CHLPD DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpoC PE=3 SV=1 4 862 7.0E-54
sp|O27126|RPOA2_METTH DNA-directed RNA polymerase subunit A'' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA2 PE=3 SV=1 1045 1470 7.0E-54
sp|A8LM41|RPOC_DINSH DNA-directed RNA polymerase subunit beta' OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpoC PE=3 SV=1 11 888 7.0E-54
sp|Q1LSX6|RPOC_BAUCH DNA-directed RNA polymerase subunit beta' OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpoC PE=3 SV=1 1 862 7.0E-54
sp|Q3B1H8|RPOC_CHLL7 DNA-directed RNA polymerase subunit beta' OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpoC PE=3 SV=1 4 871 8.0E-54
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 13 865 9.0E-54
sp|Q8U0M5|RPOA2_PYRFU DNA-directed RNA polymerase subunit A'' OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoA2 PE=1 SV=1 1043 1461 9.0E-54
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 17 865 1.0E-53
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 19 874 1.0E-53
sp|A6UV49|RPOA2_META3 DNA-directed RNA polymerase subunit A'' OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpoA2 PE=3 SV=1 1036 1468 1.0E-53
sp|B0VLZ5|RPOC_ACIBS DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain SDF) GN=rpoC PE=3 SV=1 11 862 1.0E-53
sp|B0VDH9|RPOC_ACIBY DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain AYE) GN=rpoC PE=3 SV=1 11 862 1.0E-53
sp|A3M1G4|RPOC_ACIBT DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpoC PE=3 SV=2 11 862 1.0E-53
sp|B2I1Z2|RPOC_ACIBC DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ACICU) GN=rpoC PE=3 SV=1 11 862 1.0E-53
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 17 865 1.0E-53
sp|B0TX11|RPOC_FRAP2 DNA-directed RNA polymerase subunit beta' OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpoC PE=3 SV=1 8 862 1.0E-53
sp|A1B017|RPOC_PARDP DNA-directed RNA polymerase subunit beta' OS=Paracoccus denitrificans (strain Pd 1222) GN=rpoC PE=3 SV=1 10 865 1.0E-53
sp|A5U9X9|RPOC_HAEIE DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittEE) GN=rpoC PE=3 SV=1 19 862 2.0E-53
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 17 865 2.0E-53
sp|Q4QN34|RPOC_HAEI8 DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain 86-028NP) GN=rpoC PE=3 SV=1 19 862 2.0E-53
sp|Q1RHD1|RPOC_RICBR DNA-directed RNA polymerase subunit beta' OS=Rickettsia bellii (strain RML369-C) GN=rpoC PE=3 SV=1 1 861 2.0E-53
sp|Q2GCD8|RPOC_NOVAD DNA-directed RNA polymerase subunit beta' OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpoC PE=3 SV=1 6 861 2.0E-53
sp|Q8KG14|RPOC_CHLTE DNA-directed RNA polymerase subunit beta' OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpoC PE=3 SV=1 4 871 2.0E-53
sp|Q976A6|RPOA2_SULTO DNA-directed RNA polymerase subunit A'' OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoA2 PE=3 SV=2 1068 1461 3.0E-53
sp|Q4FQH4|RPOC_PSYA2 DNA-directed RNA polymerase subunit beta' OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpoC PE=3 SV=1 17 867 3.0E-53
sp|Q2LQ86|RPOC_SYNAS DNA-directed RNA polymerase subunit beta' OS=Syntrophus aciditrophicus (strain SB) GN=rpoC PE=3 SV=1 5 861 3.0E-53
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 17 867 3.0E-53
sp|A5UH19|RPOC_HAEIG DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittGG) GN=rpoC PE=3 SV=1 19 862 3.0E-53
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|A8GV25|RPOC_RICB8 DNA-directed RNA polymerase subunit beta' OS=Rickettsia bellii (strain OSU 85-389) GN=rpoC PE=3 SV=2 1 861 4.0E-53
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 17 867 4.0E-53
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 17 867 4.0E-53
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 17 867 4.0E-53
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 13 865 4.0E-53
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|A7HNY1|RPOC_FERNB DNA-directed RNA polymerase subunit beta' OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpoC PE=3 SV=1 242 1129 4.0E-53
sp|Q7N9A3|RPOC_PHOLL DNA-directed RNA polymerase subunit beta' OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpoC PE=3 SV=1 4 867 4.0E-53
sp|P43739|RPOC_HAEIN DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpoC PE=3 SV=1 19 862 4.0E-53
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 19 874 4.0E-53
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 17 867 4.0E-53
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 19 874 5.0E-53
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 19 874 5.0E-53
sp|Q1WVA4|RPOC_LACS1 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus salivarius (strain UCC118) GN=rpoC PE=3 SV=1 17 865 5.0E-53
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 13 865 5.0E-53
sp|Q160X8|RPOC_ROSDO DNA-directed RNA polymerase subunit beta' OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpoC PE=3 SV=1 11 865 5.0E-53
sp|B3QQS1|RPOC_CHLP8 DNA-directed RNA polymerase subunit beta' OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpoC PE=3 SV=1 4 871 6.0E-53
sp|Q1Q8Q0|RPOC_PSYCK DNA-directed RNA polymerase subunit beta' OS=Psychrobacter cryohalolentis (strain K5) GN=rpoC PE=3 SV=1 17 867 7.0E-53
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 17 867 9.0E-53
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 17 865 1.0E-52
sp|B3PK31|RPOC_CELJU DNA-directed RNA polymerase subunit beta' OS=Cellvibrio japonicus (strain Ueda107) GN=rpoC PE=3 SV=2 4 862 1.0E-52
sp|P19176|RPOC_PSEPU DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida GN=rpoC PE=3 SV=3 4 862 1.0E-52
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 17 867 1.0E-52
sp|A7MXF0|RPOC_VIBCB DNA-directed RNA polymerase subunit beta' OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpoC PE=3 SV=1 4 862 1.0E-52
sp|P41185|RPOC_BUCAP DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpoC PE=3 SV=2 4 862 1.0E-52
sp|A1TYJ1|RPOC_MARHV DNA-directed RNA polymerase subunit beta' OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpoC PE=3 SV=1 4 862 1.0E-52
sp|Q1D7U2|RPOC_MYXXD DNA-directed RNA polymerase subunit beta' OS=Myxococcus xanthus (strain DK 1622) GN=rpoC PE=3 SV=1 5 861 1.0E-52
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 19 867 2.0E-52
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 19 867 2.0E-52
sp|A5VBZ7|RPOC_SPHWW DNA-directed RNA polymerase subunit beta' OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpoC PE=3 SV=1 6 861 2.0E-52
sp|A6VKC4|RPOC_ACTSZ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpoC PE=3 SV=1 11 862 2.0E-52
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 17 865 2.0E-52
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 17 865 2.0E-52
sp|Q87A33|RPOC_XYLFT DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpoC PE=3 SV=1 19 864 2.0E-52
sp|B2IA67|RPOC_XYLF2 DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M23) GN=rpoC PE=3 SV=1 19 864 2.0E-52
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 17 867 3.0E-52
sp|A7HWQ5|RPOC_PARL1 DNA-directed RNA polymerase subunit beta' OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpoC PE=3 SV=1 1 861 3.0E-52
sp|Q0ANP4|RPOC_MARMM DNA-directed RNA polymerase subunit beta' OS=Maricaulis maris (strain MCS10) GN=rpoC PE=3 SV=1 3 861 3.0E-52
sp|A6W398|RPOC_MARMS DNA-directed RNA polymerase subunit beta' OS=Marinomonas sp. (strain MWYL1) GN=rpoC PE=3 SV=1 19 862 4.0E-52
sp|B3GYV5|RPOC_ACTP7 DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpoC PE=3 SV=1 19 867 4.0E-52
sp|B0BSF6|RPOC_ACTPJ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpoC PE=3 SV=1 19 862 4.0E-52
sp|B3EER3|RPOC_CHLL2 DNA-directed RNA polymerase subunit beta' OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpoC PE=3 SV=1 4 871 4.0E-52
sp|Q1IHH5|RPOC_KORVE DNA-directed RNA polymerase subunit beta' OS=Koribacter versatilis (strain Ellin345) GN=rpoC PE=3 SV=2 19 870 5.0E-52
sp|Q9PA87|RPOC_XYLFA DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain 9a5c) GN=rpoC PE=3 SV=2 19 864 5.0E-52
sp|Q5LMQ6|RPOC_RUEPO DNA-directed RNA polymerase subunit beta' OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpoC PE=3 SV=1 12 865 5.0E-52
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 17 865 6.0E-52
sp|A3N326|RPOC_ACTP2 DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpoC PE=3 SV=1 19 867 6.0E-52
sp|A1T064|RPOC_PSYIN DNA-directed RNA polymerase subunit beta' OS=Psychromonas ingrahamii (strain 37) GN=rpoC PE=3 SV=1 242 881 6.0E-52
sp|P09847|RPOA2_METTW DNA-directed RNA polymerase subunit A'' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA2 PE=1 SV=2 1045 1467 7.0E-52
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 17 865 7.0E-52
sp|Q7VKL8|RPOC_HAEDU DNA-directed RNA polymerase subunit beta' OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpoC PE=3 SV=1 19 867 1.0E-51
sp|A7MQQ8|RPOC_CROS8 DNA-directed RNA polymerase subunit beta' OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpoC PE=3 SV=1 4 867 1.0E-51
sp|B0U5X6|RPOC_XYLFM DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M12) GN=rpoC PE=3 SV=1 19 864 1.0E-51
sp|A4SGK5|RPOC_CHLPM DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpoC PE=3 SV=1 4 874 1.0E-51
sp|A1WK56|RPOC_VEREI DNA-directed RNA polymerase subunit beta' OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpoC PE=3 SV=1 12 862 1.0E-51
sp|Q0I5B8|RPOC_HAES1 DNA-directed RNA polymerase subunit beta' OS=Haemophilus somnus (strain 129Pt) GN=rpoC PE=3 SV=1 19 862 1.0E-51
sp|B4SG10|RPOC_PELPB DNA-directed RNA polymerase subunit beta' OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpoC PE=3 SV=1 4 871 1.0E-51
sp|B0URZ7|RPOC_HISS2 DNA-directed RNA polymerase subunit beta' OS=Histophilus somni (strain 2336) GN=rpoC PE=3 SV=1 19 862 1.0E-51
sp|A1VYJ5|RPOC_CAMJJ DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpoC PE=3 SV=1 17 862 2.0E-51
sp|A8FKR4|RPOC_CAMJ8 DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpoC PE=3 SV=1 17 862 2.0E-51
sp|Q9CK92|RPOC_PASMU DNA-directed RNA polymerase subunit beta' OS=Pasteurella multocida (strain Pm70) GN=rpoC PE=3 SV=1 19 862 2.0E-51
sp|Q1GK48|RPOC_RUEST DNA-directed RNA polymerase subunit beta' OS=Ruegeria sp. (strain TM1040) GN=rpoC PE=3 SV=1 12 865 2.0E-51
sp|A1KRG7|RPOC_NEIMF DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpoC PE=3 SV=1 1 881 3.0E-51
sp|A5WH34|RPOC_PSYWF DNA-directed RNA polymerase subunit beta' OS=Psychrobacter sp. (strain PRwf-1) GN=rpoC PE=3 SV=1 14 862 3.0E-51
sp|B6IRP7|RPOC_RHOCS DNA-directed RNA polymerase subunit beta' OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpoC PE=3 SV=1 14 861 4.0E-51
sp|Q31IY8|RPOC_THICR DNA-directed RNA polymerase subunit beta' OS=Thiomicrospira crunogena (strain XCL-2) GN=rpoC PE=3 SV=1 19 862 4.0E-51
sp|A9BR99|RPOC_DELAS DNA-directed RNA polymerase subunit beta' OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpoC PE=3 SV=1 12 874 4.0E-51
sp|Q7MA56|RPOBC_WOLSU Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpoBC PE=3 SV=1 19 856 4.0E-51
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 15 862 4.0E-51
sp|A5FZX0|RPOC_ACICJ DNA-directed RNA polymerase subunit beta' OS=Acidiphilium cryptum (strain JF-5) GN=rpoC PE=3 SV=1 15 861 4.0E-51
sp|P11514|RPOA2_SULAC DNA-directed RNA polymerase subunit A'' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA2 PE=3 SV=2 1058 1471 4.0E-51
sp|A6T3L2|RPOC_JANMA DNA-directed RNA polymerase subunit beta' OS=Janthinobacterium sp. (strain Marseille) GN=rpoC PE=3 SV=1 19 862 5.0E-51
sp|Q5NPK4|RPOC_ZYMMO DNA-directed RNA polymerase subunit beta' OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpoC PE=3 SV=2 6 871 6.0E-51
sp|A1TVS9|RPOC_ACIAC DNA-directed RNA polymerase subunit beta' OS=Acidovorax citrulli (strain AAC00-1) GN=rpoC PE=3 SV=1 12 862 6.0E-51
sp|Q28UX6|RPOC_JANSC DNA-directed RNA polymerase subunit beta' OS=Jannaschia sp. (strain CCS1) GN=rpoC PE=3 SV=1 12 867 6.0E-51
sp|Q5HVY8|RPOC_CAMJR DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni (strain RM1221) GN=rpoC PE=3 SV=1 17 862 6.0E-51
sp|A1WCM8|RPOC_ACISJ DNA-directed RNA polymerase subunit beta' OS=Acidovorax sp. (strain JS42) GN=rpoC PE=3 SV=1 12 874 7.0E-51
sp|C6E4R3|RPOC_GEOSM DNA-directed RNA polymerase subunit beta' OS=Geobacter sp. (strain M21) GN=rpoC PE=3 SV=1 26 861 7.0E-51
sp|A5ELN6|RPOC_BRASB DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpoC PE=3 SV=1 1 861 8.0E-51
sp|B3QBZ9|RPOC_RHOPT DNA-directed RNA polymerase subunit beta' OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpoC PE=3 SV=1 1 861 8.0E-51
sp|Q30X04|RPOC_DESAG DNA-directed RNA polymerase subunit beta' OS=Desulfovibrio alaskensis (strain G20) GN=rpoC PE=3 SV=1 13 862 8.0E-51
sp|P0C0D9|RPOC_STRPY DNA-directed RNA polymerase subunit beta' (Fragment) OS=Streptococcus pyogenes GN=rpoC PE=3 SV=1 83 874 8.0E-51
sp|B9M6V1|RPOC_GEODF DNA-directed RNA polymerase subunit beta' OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpoC PE=3 SV=1 5 881 8.0E-51
sp|B9MH46|RPOC_ACIET DNA-directed RNA polymerase subunit beta' OS=Acidovorax ebreus (strain TPSY) GN=rpoC PE=3 SV=1 12 874 9.0E-51
sp|Q6N4S0|RPOC_RHOPA DNA-directed RNA polymerase subunit beta' OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpoC PE=3 SV=1 1 861 1.0E-50
sp|Q5X865|RPOC_LEGPA DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Paris) GN=rpoC PE=3 SV=1 19 882 1.0E-50
sp|Q9PI30|RPOC_CAMJE DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpoC PE=3 SV=1 17 862 1.0E-50
sp|Q9K1J1|RPOC_NEIMB DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpoC PE=3 SV=1 1 881 1.0E-50
sp|Q8PC55|RPOC_XANCP DNA-directed RNA polymerase subunit beta' OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpoC PE=3 SV=1 19 862 1.0E-50
sp|Q4URD3|RPOC_XANC8 DNA-directed RNA polymerase subunit beta' OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpoC PE=3 SV=1 19 862 1.0E-50
sp|Q8KTH8|RPOC_XANOR DNA-directed RNA polymerase subunit beta' OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpoC PE=1 SV=2 19 862 1.0E-50
sp|B2SQQ2|RPOC_XANOP DNA-directed RNA polymerase subunit beta' OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpoC PE=3 SV=1 19 862 1.0E-50
sp|Q2NZX9|RPOC_XANOM DNA-directed RNA polymerase subunit beta' OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpoC PE=3 SV=1 19 862 1.0E-50
sp|A9M3X3|RPOC_NEIM0 DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpoC PE=3 SV=1 1 881 1.0E-50
sp|Q7NQE7|RPOC_CHRVO DNA-directed RNA polymerase subunit beta' OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpoC PE=3 SV=1 19 890 1.0E-50
sp|B0RU88|RPOC_XANCB DNA-directed RNA polymerase subunit beta' OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpoC PE=3 SV=1 19 862 1.0E-50
sp|Q4UKD5|RPOC_RICFE DNA-directed RNA polymerase subunit beta' OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpoC PE=3 SV=1 1 861 1.0E-50
sp|A4SHV0|RPOC_AERS4 DNA-directed RNA polymerase subunit beta' OS=Aeromonas salmonicida (strain A449) GN=rpoC PE=3 SV=1 242 870 1.0E-50
sp|A5IHS0|RPOC_LEGPC DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Corby) GN=rpoC PE=3 SV=2 19 882 1.0E-50
sp|Q5WZL8|RPOC_LEGPL DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Lens) GN=rpoC PE=3 SV=1 19 882 1.0E-50
sp|Q3BWZ0|RPOC_XANC5 DNA-directed RNA polymerase subunit beta' OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpoC PE=3 SV=1 19 862 1.0E-50
sp|Q8PNS9|RPOC_XANAC DNA-directed RNA polymerase subunit beta' OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpoC PE=3 SV=1 19 862 1.0E-50
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 17 865 2.0E-50
sp|A0KQA4|RPOC_AERHH DNA-directed RNA polymerase subunit beta' OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpoC PE=3 SV=1 242 867 2.0E-50
sp|Q5ZYP9|RPOC_LEGPH DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpoC PE=3 SV=2 19 882 2.0E-50
sp|A8F0P8|RPOC_RICM5 DNA-directed RNA polymerase subunit beta' OS=Rickettsia massiliae (strain Mtu5) GN=rpoC PE=3 SV=1 1 861 2.0E-50
sp|Q8EWX0|RPOC_MYCPE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma penetrans (strain HF-2) GN=rpoC PE=3 SV=1 242 862 2.0E-50
sp|A1VTF7|RPOC_POLNA DNA-directed RNA polymerase subunit beta' OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpoC PE=3 SV=1 12 874 2.0E-50
sp|Q1CS68|RPOBC_HELPH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain HPAG1) GN=rpoBC PE=3 SV=1 242 867 3.0E-50
sp|Q8PUR2|RPOA2_METMA DNA-directed RNA polymerase subunit A'' OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpoA2 PE=3 SV=1 1057 1476 3.0E-50
sp|Q89J75|RPOC_BRADU DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpoC PE=3 SV=1 1 861 3.0E-50
sp|A7IKQ1|RPOC_XANP2 DNA-directed RNA polymerase subunit beta' OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpoC PE=3 SV=1 10 861 3.0E-50
sp|A4G9U4|RPOC_HERAR DNA-directed RNA polymerase subunit beta' OS=Herminiimonas arsenicoxydans GN=rpoC PE=3 SV=1 19 862 4.0E-50
sp|C4LBV1|RPOC_TOLAT DNA-directed RNA polymerase subunit beta' OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpoC PE=3 SV=1 242 862 4.0E-50
sp|Q6LLW3|RPOC_PHOPR DNA-directed RNA polymerase subunit beta' OS=Photobacterium profundum GN=rpoC PE=3 SV=2 243 878 5.0E-50
sp|A4YSI2|RPOC_BRASO DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium sp. (strain ORS278) GN=rpoC PE=3 SV=1 1 861 5.0E-50
sp|B5EFP4|RPOC_GEOBB DNA-directed RNA polymerase subunit beta' OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpoC PE=3 SV=1 26 861 5.0E-50
sp|A3Q976|RPOC_SHELP DNA-directed RNA polymerase subunit beta' OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpoC PE=3 SV=1 242 862 5.0E-50
sp|B2UUV9|RPOBC_HELPS Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain Shi470) GN=rpoBC PE=3 SV=1 242 867 6.0E-50
sp|A8GQW5|RPOC_RICRS DNA-directed RNA polymerase subunit beta' OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpoC PE=3 SV=1 1 861 6.0E-50
sp|B0BWB0|RPOC_RICRO DNA-directed RNA polymerase subunit beta' OS=Rickettsia rickettsii (strain Iowa) GN=rpoC PE=3 SV=1 1 861 6.0E-50
sp|Q82T76|RPOC_NITEU DNA-directed RNA polymerase subunit beta' OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpoC PE=3 SV=1 17 881 6.0E-50
sp|Q9JX03|RPOC_NEIMA DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpoC PE=3 SV=1 1 881 6.0E-50
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 17 874 7.0E-50
sp|B4RQW3|RPOC_NEIG2 DNA-directed RNA polymerase subunit beta' OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rpoC PE=3 SV=1 1 881 7.0E-50
sp|Q5F5R6|RPOC_NEIG1 DNA-directed RNA polymerase subunit beta' OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpoC PE=3 SV=1 1 881 7.0E-50
sp|Q6F0L8|RPOC_MESFL DNA-directed RNA polymerase subunit beta' OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoC PE=3 SV=1 242 862 8.0E-50
sp|Q3ATP4|RPOC_CHLCH DNA-directed RNA polymerase subunit beta' OS=Chlorobium chlorochromatii (strain CaD3) GN=rpoC PE=3 SV=1 4 871 8.0E-50
sp|A8GMA8|RPOC_RICAH DNA-directed RNA polymerase subunit beta' OS=Rickettsia akari (strain Hartford) GN=rpoC PE=3 SV=1 1 861 9.0E-50
sp|A9ADI6|RPOC_BURM1 DNA-directed RNA polymerase subunit beta' OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpoC PE=3 SV=1 19 867 1.0E-49
sp|Q9RH40|RPOC_RICCN DNA-directed RNA polymerase subunit beta' OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpoC PE=3 SV=2 1 861 1.0E-49
sp|O25806|RPOBC_HELPY Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpoBC PE=1 SV=1 242 867 1.0E-49
sp|Q9ZK23|RPOBC_HELPJ Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpoBC PE=3 SV=1 242 867 1.0E-49
sp|A0L5W7|RPOC_MAGMM DNA-directed RNA polymerase subunit beta' OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpoC PE=3 SV=1 6 865 1.0E-49
sp|Q2S1Q6|RPOC_SALRD DNA-directed RNA polymerase subunit beta' OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpoC PE=3 SV=1 19 871 1.0E-49
sp|Q17VN6|RPOBC_HELAH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter acinonychis (strain Sheeba) GN=rpoBC PE=3 SV=1 242 867 1.0E-49
sp|A8EXK9|RPOC_RICCK DNA-directed RNA polymerase subunit beta' OS=Rickettsia canadensis (strain McKiel) GN=rpoC PE=3 SV=1 1 861 1.0E-49
sp|Q39Y12|RPOC_GEOMG DNA-directed RNA polymerase subunit beta' OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpoC PE=3 SV=1 5 861 1.0E-49
sp|A9M5Q8|RPOC_BRUC2 DNA-directed RNA polymerase subunit beta' OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpoC PE=3 SV=1 1 861 1.0E-49
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 17 865 2.0E-49
sp|Q9ZE20|RPOC_RICPR DNA-directed RNA polymerase subunit beta' OS=Rickettsia prowazekii (strain Madrid E) GN=rpoC PE=3 SV=1 1 861 2.0E-49
sp|Q0BYA8|RPOC_HYPNA DNA-directed RNA polymerase subunit beta' OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpoC PE=3 SV=1 241 885 2.0E-49
sp|A9ISG4|RPOC_BART1 DNA-directed RNA polymerase subunit beta' OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpoC PE=3 SV=1 11 871 2.0E-49
sp|A6X0B0|RPOC_OCHA4 DNA-directed RNA polymerase subunit beta' OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpoC PE=3 SV=1 3 861 2.0E-49
sp|Q9LQ02|NRPD1_ARATH DNA-directed RNA polymerase IV subunit 1 OS=Arabidopsis thaliana GN=NRPD1 PE=1 SV=1 351 886 2.0E-49
sp|Q83ET0|RPOC_COXBU DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpoC PE=3 SV=1 242 862 2.0E-49
sp|A9NAL6|RPOC_COXBR DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpoC PE=3 SV=1 242 862 2.0E-49
sp|Q1GT24|RPOC_SPHAL DNA-directed RNA polymerase subunit beta' OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpoC PE=3 SV=1 6 861 2.0E-49
sp|B0CH40|RPOC_BRUSI DNA-directed RNA polymerase subunit beta' OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpoC PE=3 SV=1 1 861 2.0E-49
sp|Q8TRB8|RPOA2_METAC DNA-directed RNA polymerase subunit A'' OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpoA2 PE=3 SV=1 1068 1475 2.0E-49
sp|Q6FZM0|RPOC_BARQU DNA-directed RNA polymerase subunit beta' OS=Bartonella quintana (strain Toulouse) GN=rpoC PE=3 SV=1 11 871 3.0E-49
sp|Q8G070|RPOC_BRUSU DNA-directed RNA polymerase subunit beta' OS=Brucella suis biovar 1 (strain 1330) GN=rpoC PE=3 SV=1 1 861 3.0E-49
sp|Q68XM7|RPOC_RICTY DNA-directed RNA polymerase subunit beta' OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpoC PE=3 SV=1 1 861 3.0E-49
sp|Q4FLL3|RPOC_PELUB DNA-directed RNA polymerase subunit beta' OS=Pelagibacter ubique (strain HTCC1062) GN=rpoC PE=3 SV=1 1 863 3.0E-49
sp|A9KD37|RPOC_COXBN DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpoC PE=3 SV=1 242 862 3.0E-49
sp|C0RJK9|RPOC_BRUMB DNA-directed RNA polymerase subunit beta' OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpoC PE=3 SV=1 1 861 3.0E-49
sp|Q8YHP7|RPOC_BRUME DNA-directed RNA polymerase subunit beta' OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpoC PE=3 SV=1 1 861 3.0E-49
sp|A8EVZ3|RPOC_ARCB4 DNA-directed RNA polymerase subunit beta' OS=Arcobacter butzleri (strain RM4018) GN=rpoC PE=3 SV=1 20 856 3.0E-49
sp|Q3Z8V3|RPOC_DEHM1 DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpoC PE=3 SV=1 242 862 3.0E-49
sp|Q57CP9|RPOC_BRUAB DNA-directed RNA polymerase subunit beta' OS=Brucella abortus biovar 1 (strain 9-941) GN=rpoC PE=3 SV=1 1 861 3.0E-49
sp|Q2YM16|RPOC_BRUA2 DNA-directed RNA polymerase subunit beta' OS=Brucella abortus (strain 2308) GN=rpoC PE=3 SV=1 1 861 3.0E-49
sp|B2S686|RPOC_BRUA1 DNA-directed RNA polymerase subunit beta' OS=Brucella abortus (strain S19) GN=rpoC PE=3 SV=1 1 861 3.0E-49
sp|Q5E239|RPOC_VIBF1 DNA-directed RNA polymerase subunit beta' OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpoC PE=3 SV=2 243 867 3.0E-49
sp|A5VR14|RPOC_BRUO2 DNA-directed RNA polymerase subunit beta' OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpoC PE=3 SV=1 1 861 3.0E-49
sp|Q0VSM1|RPOC_ALCBS DNA-directed RNA polymerase subunit beta' OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpoC PE=3 SV=1 243 866 4.0E-49
sp|Q6G3X4|RPOC_BARHE DNA-directed RNA polymerase subunit beta' OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpoC PE=3 SV=1 11 871 4.0E-49
sp|Q9AAU1|RPOC_CAUCR DNA-directed RNA polymerase subunit beta' OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpoC PE=3 SV=1 242 861 4.0E-49
sp|Q492C0|RPOC_BLOPB DNA-directed RNA polymerase subunit beta' OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpoC PE=3 SV=1 242 867 4.0E-49
sp|A5GAY2|RPOC_GEOUR DNA-directed RNA polymerase subunit beta' OS=Geobacter uraniireducens (strain Rf4) GN=rpoC PE=3 SV=1 5 861 5.0E-49
sp|Q0AF54|RPOC_NITEC DNA-directed RNA polymerase subunit beta' OS=Nitrosomonas eutropha (strain C91) GN=rpoC PE=3 SV=1 17 862 5.0E-49
sp|B4E5B3|RPOC_BURCJ DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpoC PE=3 SV=1 19 867 5.0E-49
sp|B6JES1|RPOC_OLICO DNA-directed RNA polymerase subunit beta' OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpoC PE=3 SV=1 1 861 5.0E-49
sp|Q2IXR9|RPOC_RHOP2 DNA-directed RNA polymerase subunit beta' OS=Rhodopseudomonas palustris (strain HaA2) GN=rpoC PE=3 SV=1 1 861 5.0E-49
sp|Q123G4|RPOC_POLSJ DNA-directed RNA polymerase subunit beta' OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpoC PE=3 SV=1 12 874 6.0E-49
sp|Q0BJ53|RPOC_BURCM DNA-directed RNA polymerase subunit beta' OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpoC PE=3 SV=1 19 867 6.0E-49
sp|B1YRC3|RPOC_BURA4 DNA-directed RNA polymerase subunit beta' OS=Burkholderia ambifaria (strain MC40-6) GN=rpoC PE=3 SV=1 19 867 6.0E-49
sp|A4JAN3|RPOC_BURVG DNA-directed RNA polymerase subunit beta' OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpoC PE=3 SV=1 19 867 6.0E-49
sp|B1Y7H2|RPOC_LEPCP DNA-directed RNA polymerase subunit beta' OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpoC PE=3 SV=1 12 862 7.0E-49
sp|Q03PV0|RPOC_LACBA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoC PE=3 SV=1 17 865 8.0E-49
sp|Q6MJ10|RPOC_BDEBA DNA-directed RNA polymerase subunit beta' OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpoC PE=3 SV=1 5 879 1.0E-48
sp|B3E7S9|RPOC_GEOLS DNA-directed RNA polymerase subunit beta' OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpoC PE=3 SV=1 5 861 1.0E-48
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 17 865 1.0E-48
sp|Q2YB04|RPOC_NITMU DNA-directed RNA polymerase subunit beta' OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpoC PE=3 SV=1 17 862 1.0E-48
sp|Q21M92|RPOC_SACD2 DNA-directed RNA polymerase subunit beta' OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpoC PE=3 SV=1 4 862 1.0E-48
sp|Q0K607|RPOC_CUPNH DNA-directed RNA polymerase subunit beta' OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpoC PE=3 SV=1 19 867 2.0E-48
sp|Q9KV29|RPOC_VIBCH DNA-directed RNA polymerase subunit beta' OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpoC PE=3 SV=1 242 862 2.0E-48
sp|A5F3P6|RPOC_VIBC3 DNA-directed RNA polymerase subunit beta' OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpoC PE=3 SV=1 242 862 2.0E-48
sp|A1KB33|RPOC_AZOSB DNA-directed RNA polymerase subunit beta' OS=Azoarcus sp. (strain BH72) GN=rpoC PE=3 SV=1 19 862 2.0E-48
sp|B2FQ39|RPOC_STRMK DNA-directed RNA polymerase subunit beta' OS=Stenotrophomonas maltophilia (strain K279a) GN=rpoC PE=3 SV=1 19 862 3.0E-48
sp|Q39KH4|RPOC_BURL3 DNA-directed RNA polymerase subunit beta' OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpoC PE=3 SV=1 19 867 3.0E-48
sp|Q98N65|RPOC_RHILO DNA-directed RNA polymerase subunit beta' OS=Rhizobium loti (strain MAFF303099) GN=rpoC PE=3 SV=1 3 861 4.0E-48
sp|Q46WD5|RPOC_CUPPJ DNA-directed RNA polymerase subunit beta' OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpoC PE=3 SV=1 19 867 4.0E-48
sp|Q134R9|RPOC_RHOPS DNA-directed RNA polymerase subunit beta' OS=Rhodopseudomonas palustris (strain BisB5) GN=rpoC PE=3 SV=1 1 861 4.0E-48
sp|B3R7T5|RPOC_CUPTR DNA-directed RNA polymerase subunit beta' OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpoC PE=3 SV=1 19 867 4.0E-48
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 17 865 4.0E-48
sp|A8HTZ1|RPOC_AZOC5 DNA-directed RNA polymerase subunit beta' OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpoC PE=3 SV=1 3 861 5.0E-48
sp|B2JIH3|RPOC_BURP8 DNA-directed RNA polymerase subunit beta' OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpoC PE=3 SV=1 19 867 5.0E-48
sp|Q87KQ5|RPOC_VIBPA DNA-directed RNA polymerase subunit beta' OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpoC PE=3 SV=1 243 862 5.0E-48
sp|B4UDT1|RPOC_ANASK DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter sp. (strain K) GN=rpoC PE=3 SV=1 5 867 6.0E-48
sp|Q1H4P3|RPOC_METFK DNA-directed RNA polymerase subunit beta' OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpoC PE=3 SV=1 19 862 6.0E-48
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 82 865 6.0E-48
sp|P47716|RPOC_MYCGA DNA-directed RNA polymerase subunit beta' OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpoC PE=3 SV=2 19 862 7.0E-48
sp|A2SLG4|RPOC_METPP DNA-directed RNA polymerase subunit beta' OS=Methylibium petroleiphilum (strain PM1) GN=rpoC PE=3 SV=1 12 867 7.0E-48
sp|A0K3L8|RPOC_BURCH DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain HI2424) GN=rpoC PE=3 SV=1 19 867 8.0E-48
sp|B1JU15|RPOC_BURCC DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain MC0-3) GN=rpoC PE=3 SV=1 19 867 8.0E-48
sp|Q1BRU1|RPOC_BURCA DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain AU 1054) GN=rpoC PE=3 SV=1 19 867 8.0E-48
sp|Q11HB4|RPOC_CHESB DNA-directed RNA polymerase subunit beta' OS=Chelativorans sp. (strain BNC1) GN=rpoC PE=3 SV=1 3 861 9.0E-48
sp|B2RL44|RPOC_PORG3 DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpoC PE=3 SV=1 242 882 9.0E-48
sp|Q3J8Q8|RPOC_NITOC DNA-directed RNA polymerase subunit beta' OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpoC PE=3 SV=1 242 885 9.0E-48
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 17 865 9.0E-48
sp|Q7MX26|RPOC_PORGI DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpoC PE=3 SV=1 242 882 1.0E-47
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 1050 1466 3.0E-46
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 1050 1466 3.0E-46
sp|Q5ZL98|RPC1_CHICK DNA-directed RNA polymerase III subunit RPC1 OS=Gallus gallus GN=POLR3A PE=2 SV=1 1050 1466 2.0E-45
sp|F4JXF9|NRPC1_ARATH DNA-directed RNA polymerase III subunit 1 OS=Arabidopsis thaliana GN=NRPC1 PE=2 SV=1 1067 1466 7.0E-43
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 1052 1468 2.0E-40
sp|O55766|RPB1_IIV6 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-176R PE=3 SV=1 11 410 4.0E-37
sp|Q196X0|RPB1_IIV3 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-090L PE=3 SV=1 1064 1507 6.0E-33
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1603 1738 2.0E-30
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1561 1751 2.0E-29
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1607 1735 8.0E-29
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 1603 1737 1.0E-25
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1578 1706 2.0E-25
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1578 1706 3.0E-25
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1625 1753 7.0E-25
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1625 1753 2.0E-24
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 1567 1738 3.0E-24
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 242 426 2.0E-22
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 1284 1466 1.0E-21
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1048 1166 1.0E-21
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 1036 1137 4.0E-21
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1324 1471 8.0E-21
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 1064 1136 5.0E-20
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 1287 1466 2.0E-18
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 1271 1466 3.0E-18
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 1625 1752 4.0E-17
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 1064 1133 4.0E-17
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1067 1189 6.0E-17
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 1068 1171 3.0E-16
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 1561 1669 1.0E-15
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 1328 1466 1.0E-15
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1058 1135 1.0E-15
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1561 1655 2.0E-14
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1561 1655 2.0E-14
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 1339 1466 2.0E-14
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1553 1670 3.0E-14
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 1328 1465 5.0E-14
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 1325 1465 3.0E-13
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1342 1466 4.0E-13
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 14 121 6.0E-13
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1328 1465 1.0E-12
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 18 125 5.0E-12
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 11 124 1.0E-11
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 16 112 1.0E-11
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 16 112 1.0E-11
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1043 1152 1.0E-11
sp|Q6GZW7|RPB1_FRG3G Putative DNA-directed RNA polymerase 008R OS=Frog virus 3 (isolate Goorha) GN=FV3-008R PE=3 SV=1 1284 1443 8.0E-11
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 16 112 9.0E-11
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 12 112 2.0E-10
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 1073 1169 6.0E-10
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 12 112 7.0E-10
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 1073 1156 1.0E-09
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 1073 1156 1.0E-09
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 1073 1156 1.0E-09
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 1073 1156 1.0E-09
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 1073 1156 1.0E-09
sp|B2SFD7|RPOC_FRATM DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpoC PE=3 SV=1 1073 1461 1.0E-09
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 1073 1156 2.0E-09
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 12 112 4.0E-09
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 1065 1120 6.0E-09
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 1071 1152 6.0E-09
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 1073 1124 7.0E-09
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 1073 1152 1.0E-08
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 1032 1124 1.0E-08
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 1032 1124 1.0E-08
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 1073 1169 1.0E-08
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 1076 1152 1.0E-08
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 1073 1152 1.0E-08
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 1073 1120 1.0E-08
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 1073 1120 1.0E-08
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 1073 1120 1.0E-08
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 1073 1120 1.0E-08
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 1073 1149 2.0E-08
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 1073 1156 2.0E-08
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 1073 1156 2.0E-08
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 1073 1156 2.0E-08
sp|A9KJL3|RPOC_CLOPH DNA-directed RNA polymerase subunit beta' OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpoC PE=3 SV=1 1073 1124 2.0E-08
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 1071 1120 2.0E-08
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 1073 1124 2.0E-08
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 1073 1124 2.0E-08
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 1071 1120 2.0E-08
sp|Q6F0L8|RPOC_MESFL DNA-directed RNA polymerase subunit beta' OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoC PE=3 SV=1 1055 1122 2.0E-08
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 1073 1124 3.0E-08
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 1073 1124 3.0E-08
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 1071 1120 3.0E-08
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 1076 1124 3.0E-08
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 1073 1120 3.0E-08
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 1073 1124 3.0E-08
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 1073 1120 3.0E-08
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 1073 1120 3.0E-08
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 1073 1120 3.0E-08
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 1071 1120 3.0E-08
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 1073 1120 4.0E-08
sp|B2UYA4|RPOC_CLOBA DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpoC PE=3 SV=1 1073 1124 4.0E-08
sp|B2TIG9|RPOC_CLOBB DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpoC PE=3 SV=1 1073 1124 4.0E-08
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 1073 1120 4.0E-08
sp|A4J104|RPOC_DESRM DNA-directed RNA polymerase subunit beta' OS=Desulfotomaculum reducens (strain MI-1) GN=rpoC PE=3 SV=1 1073 1120 5.0E-08
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 1050 1124 5.0E-08
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 1073 1152 6.0E-08
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 1073 1156 9.0E-08
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 1073 1156 1.0E-07
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 1073 1150 1.0E-07
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 1073 1150 1.0E-07
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 1073 1150 1.0E-07
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 1073 1120 1.0E-07
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 1073 1120 1.0E-07
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 1073 1120 1.0E-07
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 1073 1124 2.0E-07
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 1073 1120 2.0E-07
sp|P0C0D9|RPOC_STRPY DNA-directed RNA polymerase subunit beta' (Fragment) OS=Streptococcus pyogenes GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 1072 1120 2.0E-07
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 1073 1120 3.0E-07
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 1073 1120 3.0E-07
sp|Q8EWX0|RPOC_MYCPE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma penetrans (strain HF-2) GN=rpoC PE=3 SV=1 1310 1461 4.0E-07
sp|Q3Z8V3|RPOC_DEHM1 DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpoC PE=3 SV=1 1050 1120 4.0E-07
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 1073 1120 5.0E-07
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 1073 1120 5.0E-07
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 1073 1120 7.0E-07
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 1073 1120 7.0E-07
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1593 1714 9.0E-07
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 1073 1120 9.0E-07
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 1073 1120 9.0E-07
sp|Q9LQ02|NRPD1_ARATH DNA-directed RNA polymerase IV subunit 1 OS=Arabidopsis thaliana GN=NRPD1 PE=1 SV=1 1341 1471 9.0E-07
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 1073 1120 1.0E-06
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 1073 1120 1.0E-06
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1325 1479 2.0E-06
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 1324 1461 2.0E-06
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 1073 1120 2.0E-06
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 1073 1120 2.0E-06
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 1073 1120 2.0E-06
sp|P47716|RPOC_MYCGA DNA-directed RNA polymerase subunit beta' OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpoC PE=3 SV=2 1072 1123 2.0E-06
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 1073 1130 2.0E-06
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 1066 1108 3.0E-06
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 1073 1120 3.0E-06
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 1635 1739 5.0E-06
sp|A9KJL3|RPOC_CLOPH DNA-directed RNA polymerase subunit beta' OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpoC PE=3 SV=1 1357 1461 7.0E-06
sp|B2VG97|RPOC_ERWT9 DNA-directed RNA polymerase subunit beta' OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpoC PE=3 SV=1 1337 1461 7.0E-06
sp|Q7NQE7|RPOC_CHRVO DNA-directed RNA polymerase subunit beta' OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpoC PE=3 SV=1 986 1108 7.0E-06
sp|C4LBV1|RPOC_TOLAT DNA-directed RNA polymerase subunit beta' OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpoC PE=3 SV=1 1357 1461 7.0E-06
sp|B4E5B3|RPOC_BURCJ DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpoC PE=3 SV=1 1357 1461 9.0E-06
sp|Q0BJ53|RPOC_BURCM DNA-directed RNA polymerase subunit beta' OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpoC PE=3 SV=1 1357 1461 9.0E-06
sp|B1YRC3|RPOC_BURA4 DNA-directed RNA polymerase subunit beta' OS=Burkholderia ambifaria (strain MC40-6) GN=rpoC PE=3 SV=1 1357 1461 9.0E-06
sp|A4JAN3|RPOC_BURVG DNA-directed RNA polymerase subunit beta' OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpoC PE=3 SV=1 1357 1461 9.0E-06
sp|Q39KH4|RPOC_BURL3 DNA-directed RNA polymerase subunit beta' OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpoC PE=3 SV=1 1357 1461 9.0E-06
sp|A0K3L8|RPOC_BURCH DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain HI2424) GN=rpoC PE=3 SV=1 1357 1461 9.0E-06
sp|B1JU15|RPOC_BURCC DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain MC0-3) GN=rpoC PE=3 SV=1 1357 1461 9.0E-06
sp|Q1BRU1|RPOC_BURCA DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain AU 1054) GN=rpoC PE=3 SV=1 1357 1461 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0097747 RNA polymerase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4522
MANLYFTHSSAPLKTVEEIQFGLMSPEEIKNMSVAHILYPETMEENKTKPRDGGLNDPLLGSIDRQFKCKTCTQA
MGECPGHFGHIELAKPVYHPGFIKKVKKILEIVCHNCSKVLADTSDPEFVTAINTRDPKLRFNRVWTVCKKKRRC
ENEDRQSKDKDEEFAPGMKLPNAVDNHGGCGNVQPAVRQAALQLKAAFEVAQEDGPKRKETVPITPEMAHGILRR
ISEDDLRNMGLNCDYARPEWMIVTVLPVPPPPVRPSISMDGTGTGMRNEDDLTYKLGDIIRANGNVKQAIREGSP
QHIARDFEELLQYHVATYMDNDIAGQPRALQKSGRPVKAIRARLKGKEGRLRGNLMGKRVDFSARTVITGDANIS
LHEVGVPRSIARTLTYPETVTPYNIGKLHQLVENGPNEHPGAKYVIRSDGTRIDLRHHRRAAQISLEYGWKVERH
LMDGDYIIFNRQPSLHKESMMGHRVRVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAEIKELCLVPNN
IVSPQKNGPLMGIVQDSLAGAYKLCRRDTFIDKEMVMNLMLWVPHWDGVIPPPAILKPRPRWTGKQIISMVIPQE
ISLHTPEGDSDIPLKDTGLLIQSGQLMYGLLKKKNIGSAAGGIVHLCYNELGPDGAMAFLNGVQQVVTYWLLHNG
HSIGIGDTVPDKQTIEKVQVHIDVQKAEVARLTAQATANELEALPGMNVRATFENKVSMALNQARDQAGTTTQKS
LKDSNNAVTMAESGSKGSSINISQMTALVGQQIVEGKRIPFGFKYRTLPHFTKDDYSPEARGFVENSYLRGLTPS
EFFFHAMAGREGLIDTAVKTAETGYIQRRLVKALEDLSARYDGTVRNSLGDIVQFLYGEDGLDAMCIEKQKLGVL
KMSDPAFEKKYRLDLANPPEWFRTDYEYGNELTGDKASMALLDEEWEALLRDRREVRLINKSKMGEEMMQLPLNI
GRIIETAKRVFNVKATDRSNLRPSDVIPAVQKVLANMKIVRGPDPISWEADANATILIKALLRSRLAFKEIVKEH
RLNRLAFDHVLGELQNRWDRSFVSPGEMVGVLAAQSIGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEILNLAKD
IKTPSMAVYLNTTLGKQEEAKKLRSMVEYTNLRSITSVTEIYYDPDIQGTSIAEDVDMVESYFLIPDDSQDTLEQ
QSRWLLRITLDRQKLLDKEIKIDDVAQRIKEEYPHDLGIIFSDNNADEQVIRIRTIRQDDEKDENGEKRIEDDVM
LKRLESHLLDTLTLRGVPGIERAFLTKGTRLVEGPDGAELAIKDDPRCTQWYLDTSGSALREVLAVDGVDPTRTY
TNDLWQIVEVFGIEAARSALVKELTNVLAFDGSYVNHRHIALLTDVMTYRGTISAVTRHGINRADTGALMRCSFE
ETVEILLEAAATGELDDCRGISENVMLGQMAPMGTGNFDVLLDPKMLETVISDNSRMGLMPGMPTKDGEAEGAAT
PYDTGSPMADSGYMSLSSPAAGNFSPIQGAGSETPAGFGTEYGGIGFGGIGSMSPYARGATSPFSTSPTSPFSGM
GGYSPSSPNAGYSPTSPLIDGGGGRYATSPSFSPSSPSFSPTSPMLRPTSPASPNYSPTSPSYSPASPSSPRHYS
PTSPAQFNSPTSPSYSPASPNYSPASPNLHGAGPTSPSYSPASPSWSPTSPEAYSPTSPGFSRSPGTQQSPTSPS
YSPTSPSFSPRTPGPGNSGNQYSPNSPAND*
Coding >Hirsu2|4522
ATGGCGAACCTTTACTTCACCCACTCGAGCGCGCCGCTCAAGACGGTAGAGGAGATTCAGTTCGGGCTCATGTCT
CCCGAGGAGATCAAGAATATGAGTGTCGCCCACATCCTCTATCCGGAGACAATGGAGGAGAACAAGACAAAGCCG
CGAGATGGAGGCCTCAACGACCCGCTGCTCGGGTCCATAGACCGCCAGTTCAAGTGCAAGACCTGTACGCAGGCC
ATGGGCGAATGCCCCGGCCACTTTGGCCACATCGAACTGGCCAAGCCAGTCTACCACCCAGGTTTCATCAAGAAG
GTCAAGAAGATCTTGGAGATTGTCTGCCATAACTGCAGCAAGGTGTTGGCCGATACTAGTGACCCCGAGTTCGTC
ACTGCCATCAACACCAGGGACCCCAAGCTTCGCTTCAACCGCGTCTGGACGGTTTGCAAGAAGAAGAGGAGATGC
GAGAACGAGGACCGTCAAAGCAAGGATAAGGATGAGGAGTTCGCGCCCGGCATGAAACTGCCCAACGCCGTCGAC
AACCACGGCGGCTGCGGCAACGTTCAGCCCGCCGTCCGGCAGGCCGCGCTGCAGCTCAAGGCGGCCTTCGAAGTC
GCCCAGGAAGACGGACCCAAGCGTAAGGAAACCGTCCCCATCACGCCCGAGATGGCCCACGGCATCCTCCGACGC
ATTTCCGAGGACGACTTGCGCAACATGGGCCTCAACTGCGACTACGCGCGCCCCGAATGGATGATCGTCACCGTC
CTGCCGGTGCCCCCCCCGCCCGTTCGCCCCAGCATCTCCATGGACGGCACCGGAACCGGAATGCGGAACGAAGAT
GATTTGACCTACAAGCTCGGCGACATCATCCGCGCCAACGGCAACGTGAAGCAAGCCATCCGCGAGGGCTCCCCT
CAGCACATCGCCAGGGATTTTGAAGAGCTGCTCCAGTACCACGTCGCCACGTACATGGACAACGACATCGCGGGC
CAGCCCCGCGCGCTGCAGAAGAGCGGACGACCCGTCAAGGCCATCCGGGCTCGCTTAAAGGGAAAGGAGGGCCGT
CTGCGAGGCAACTTGATGGGGAAGCGTGTCGACTTCTCTGCCCGTACCGTCATCACCGGAGATGCCAACATTTCG
CTCCACGAAGTCGGCGTCCCTCGCAGCATTGCAAGGACCCTCACTTACCCGGAGACCGTCACCCCCTACAACATC
GGCAAGCTGCATCAGCTGGTGGAAAACGGTCCGAACGAGCATCCCGGCGCCAAGTACGTGATCCGCTCCGACGGC
ACGCGTATCGATCTCCGCCACCACAGACGCGCGGCACAGATCTCGCTGGAGTACGGGTGGAAAGTCGAGCGTCAC
CTCATGGATGGCGACTACATCATCTTCAATCGTCAACCATCGCTGCACAAAGAGTCGATGATGGGTCACCGCGTC
CGCGTCATGCCTTACTCTACGTTTCGGCTGAACCTGTCCGTCACCTCGCCGTACAATGCCGATTTCGATGGTGAC
GAGATGAATCTGCACGTCCCTCAGAGCGAGGAAACTCGCGCCGAGATCAAGGAGCTATGCCTGGTTCCGAACAAC
ATCGTCTCCCCGCAGAAGAACGGTCCCCTGATGGGCATCGTCCAGGACTCCCTGGCTGGAGCCTACAAACTCTGC
CGACGAGACACCTTCATCGACAAAGAGATGGTGATGAACCTCATGCTTTGGGTCCCGCACTGGGACGGCGTCATC
CCCCCCCCAGCCATCCTCAAGCCTCGGCCGCGCTGGACGGGGAAGCAGATCATCAGCATGGTCATCCCGCAGGAA
ATCAGCCTGCACACCCCCGAGGGTGACTCTGACATTCCGCTGAAGGACACCGGTCTTCTCATCCAGAGCGGCCAG
CTCATGTATGGTCTGCTGAAGAAGAAGAACATTGGTTCTGCCGCGGGTGGCATAGTGCATCTCTGCTACAACGAG
CTGGGACCCGATGGGGCCATGGCCTTCCTCAACGGCGTACAGCAAGTCGTCACGTACTGGCTCCTGCACAACGGA
CATAGTATTGGCATTGGCGACACGGTCCCCGACAAGCAGACCATCGAGAAGGTCCAAGTCCACATCGACGTCCAG
AAGGCCGAGGTGGCCAGGCTGACGGCGCAGGCCACCGCCAACGAGCTTGAGGCCCTTCCCGGCATGAACGTCCGA
GCTACCTTCGAGAACAAAGTCTCCATGGCCCTTAACCAGGCCCGTGATCAAGCTGGTACTACGACGCAGAAGAGC
TTGAAGGACTCGAACAACGCTGTCACGATGGCCGAGTCCGGCTCCAAGGGCTCGTCCATCAACATTTCCCAGATG
ACCGCTCTGGTCGGGCAACAAATCGTCGAAGGCAAACGCATCCCGTTCGGCTTCAAGTACAGGACGCTCCCGCAC
TTCACCAAGGACGATTACTCGCCGGAGGCCCGTGGCTTTGTCGAGAACTCGTATCTCCGCGGCCTCACGCCCTCG
GAATTCTTCTTCCACGCCATGGCCGGTCGAGAAGGTCTCATTGACACTGCTGTCAAGACTGCAGAAACCGGATAC
ATCCAGCGTCGGCTTGTGAAAGCCCTCGAAGACCTCAGCGCCCGTTACGACGGTACTGTCCGGAACTCCCTTGGC
GACATCGTGCAGTTCCTATACGGTGAGGACGGTCTGGACGCTATGTGCATTGAGAAGCAGAAGCTCGGAGTCCTC
AAGATGTCGGATCCTGCATTTGAGAAGAAGTATCGTTTGGACCTGGCGAATCCACCCGAGTGGTTCCGGACGGAC
TACGAGTACGGCAATGAGTTGACAGGAGACAAAGCTTCCATGGCCCTCCTGGACGAGGAGTGGGAAGCTCTCCTG
CGTGACCGACGTGAAGTTCGCCTGATCAATAAGTCCAAGATGGGAGAGGAGATGATGCAGCTCCCACTCAATATT
GGCCGTATAATCGAGACGGCTAAGCGGGTCTTCAACGTCAAGGCGACGGATCGCAGTAACCTTCGCCCGTCAGAC
GTCATCCCGGCCGTCCAGAAGGTTCTCGCCAACATGAAGATCGTGCGAGGCCCGGATCCGATATCCTGGGAGGCG
GACGCCAATGCCACCATCCTGATCAAGGCCCTGCTGCGATCCCGGCTTGCGTTCAAGGAGATTGTCAAGGAACAC
CGCCTGAACAGGCTGGCCTTCGACCACGTGCTGGGAGAGCTGCAGAACCGCTGGGACCGGTCTTTCGTCAGCCCC
GGCGAAATGGTTGGTGTTCTCGCGGCGCAGTCGATTGGTGAGCCGGCAACGCAGATGACGCTCAACACTTTCCAC
TTTGCTGGTGTCTCGTCCAAGAACGTGACGCTCGGTGTGCCTCGACTCAAGGAGATTCTCAACCTGGCAAAGGAC
ATCAAAACCCCCAGCATGGCCGTCTACTTGAACACGACCTTGGGCAAGCAGGAAGAGGCGAAGAAGCTGCGAAGC
ATGGTGGAGTACACCAATCTGAGATCCATCACGTCCGTGACCGAGATTTACTACGATCCTGATATCCAGGGCACC
AGCATAGCCGAGGATGTCGACATGGTCGAGTCCTACTTTTTGATCCCCGACGACAGCCAGGACACCCTTGAACAA
CAGTCGAGGTGGCTCCTGCGCATCACGCTGGATCGTCAGAAGTTGCTGGATAAGGAGATCAAGATCGACGACGTT
GCCCAGCGAATCAAGGAGGAATACCCCCACGACCTGGGCATCATTTTCAGCGACAACAACGCGGATGAGCAGGTG
ATCCGCATCCGAACCATCAGGCAGGACGATGAGAAGGACGAGAATGGCGAGAAGCGTATCGAGGACGACGTCATG
CTCAAACGCCTCGAGTCTCATCTGCTGGACACCCTGACCCTTCGTGGCGTGCCGGGCATCGAACGGGCTTTTCTC
ACCAAGGGTACCCGCCTCGTCGAGGGCCCGGATGGAGCAGAGCTAGCCATCAAGGACGATCCGCGATGCACACAG
TGGTACCTGGACACCAGCGGTTCGGCCCTGCGCGAGGTACTCGCCGTCGACGGCGTCGATCCGACGCGGACGTAC
ACCAACGACCTGTGGCAGATCGTCGAGGTCTTTGGCATCGAGGCGGCGCGATCGGCGCTGGTCAAGGAATTGACG
AATGTGTTGGCCTTTGACGGCTCGTACGTCAACCACCGGCACATTGCGCTGCTGACGGACGTCATGACGTACCGC
GGCACCATCTCGGCCGTGACGCGCCACGGCATCAACCGGGCGGACACGGGCGCGCTGATGCGCTGCTCCTTCGAG
GAAACGGTAGAAATCCTGCTCGAGGCCGCCGCCACGGGCGAGCTCGACGACTGTCGCGGCATTTCCGAAAATGTC
ATGCTCGGGCAGATGGCGCCCATGGGGACGGGCAACTTCGACGTTCTGCTCGACCCAAAGATGCTGGAAACGGTC
ATCTCGGACAACTCGCGCATGGGCCTCATGCCAGGAATGCCGACCAAGGATGGCGAGGCGGAGGGAGCGGCAACA
CCGTACGACACGGGATCGCCCATGGCGGACTCGGGCTACATGAGCCTCAGCTCGCCGGCGGCCGGAAACTTCTCC
CCCATCCAGGGCGCTGGGTCGGAGACGCCGGCCGGGTTCGGGACGGAGTACGGCGGCATCGGCTTCGGCGGCATA
GGATCCATGAGCCCCTACGCGCGCGGAGCCACGAGCCCGTTCAGCACGTCGCCGACGTCGCCGTTCAGCGGCATG
GGCGGATACTCGCCGTCGTCGCCCAACGCGGGCTACTCGCCGACGTCGCCGCTGATCGACGGTGGCGGCGGGCGC
TACGCCACGTCGCCGTCGTTCAGCCCCTCCTCGCCGTCGTTCTCGCCGACTTCGCCGATGCTGCGGCCGACCAGC
CCGGCCAGTCCCAACTACAGCCCGACGTCGCCGAGCTATTCGCCTGCATCTCCGTCGTCCCCAAGGCACTACTCG
CCGACGTCGCCGGCGCAGTTCAACTCGCCGACGTCTCCGAGCTATTCGCCGGCCAGCCCCAACTACAGCCCGGCG
TCGCCCAACCTGCACGGGGCCGGACCGACGTCTCCCTCGTACTCGCCGGCCTCTCCCTCGTGGTCACCGACGTCC
CCGGAGGCCTACTCGCCCACGAGCCCGGGATTCTCGAGGAGCCCGGGGACGCAGCAGTCGCCGACGAGCCCCAGC
TACTCCCCGACGTCTCCGTCTTTTTCTCCCCGGACGCCCGGTCCGGGCAACTCGGGCAATCAGTATTCTCCAAAC
TCGCCGGCCAACGACTGA
Transcript >Hirsu2|4522
ATGGCGAACCTTTACTTCACCCACTCGAGCGCGCCGCTCAAGACGGTAGAGGAGATTCAGTTCGGGCTCATGTCT
CCCGAGGAGATCAAGAATATGAGTGTCGCCCACATCCTCTATCCGGAGACAATGGAGGAGAACAAGACAAAGCCG
CGAGATGGAGGCCTCAACGACCCGCTGCTCGGGTCCATAGACCGCCAGTTCAAGTGCAAGACCTGTACGCAGGCC
ATGGGCGAATGCCCCGGCCACTTTGGCCACATCGAACTGGCCAAGCCAGTCTACCACCCAGGTTTCATCAAGAAG
GTCAAGAAGATCTTGGAGATTGTCTGCCATAACTGCAGCAAGGTGTTGGCCGATACTAGTGACCCCGAGTTCGTC
ACTGCCATCAACACCAGGGACCCCAAGCTTCGCTTCAACCGCGTCTGGACGGTTTGCAAGAAGAAGAGGAGATGC
GAGAACGAGGACCGTCAAAGCAAGGATAAGGATGAGGAGTTCGCGCCCGGCATGAAACTGCCCAACGCCGTCGAC
AACCACGGCGGCTGCGGCAACGTTCAGCCCGCCGTCCGGCAGGCCGCGCTGCAGCTCAAGGCGGCCTTCGAAGTC
GCCCAGGAAGACGGACCCAAGCGTAAGGAAACCGTCCCCATCACGCCCGAGATGGCCCACGGCATCCTCCGACGC
ATTTCCGAGGACGACTTGCGCAACATGGGCCTCAACTGCGACTACGCGCGCCCCGAATGGATGATCGTCACCGTC
CTGCCGGTGCCCCCCCCGCCCGTTCGCCCCAGCATCTCCATGGACGGCACCGGAACCGGAATGCGGAACGAAGAT
GATTTGACCTACAAGCTCGGCGACATCATCCGCGCCAACGGCAACGTGAAGCAAGCCATCCGCGAGGGCTCCCCT
CAGCACATCGCCAGGGATTTTGAAGAGCTGCTCCAGTACCACGTCGCCACGTACATGGACAACGACATCGCGGGC
CAGCCCCGCGCGCTGCAGAAGAGCGGACGACCCGTCAAGGCCATCCGGGCTCGCTTAAAGGGAAAGGAGGGCCGT
CTGCGAGGCAACTTGATGGGGAAGCGTGTCGACTTCTCTGCCCGTACCGTCATCACCGGAGATGCCAACATTTCG
CTCCACGAAGTCGGCGTCCCTCGCAGCATTGCAAGGACCCTCACTTACCCGGAGACCGTCACCCCCTACAACATC
GGCAAGCTGCATCAGCTGGTGGAAAACGGTCCGAACGAGCATCCCGGCGCCAAGTACGTGATCCGCTCCGACGGC
ACGCGTATCGATCTCCGCCACCACAGACGCGCGGCACAGATCTCGCTGGAGTACGGGTGGAAAGTCGAGCGTCAC
CTCATGGATGGCGACTACATCATCTTCAATCGTCAACCATCGCTGCACAAAGAGTCGATGATGGGTCACCGCGTC
CGCGTCATGCCTTACTCTACGTTTCGGCTGAACCTGTCCGTCACCTCGCCGTACAATGCCGATTTCGATGGTGAC
GAGATGAATCTGCACGTCCCTCAGAGCGAGGAAACTCGCGCCGAGATCAAGGAGCTATGCCTGGTTCCGAACAAC
ATCGTCTCCCCGCAGAAGAACGGTCCCCTGATGGGCATCGTCCAGGACTCCCTGGCTGGAGCCTACAAACTCTGC
CGACGAGACACCTTCATCGACAAAGAGATGGTGATGAACCTCATGCTTTGGGTCCCGCACTGGGACGGCGTCATC
CCCCCCCCAGCCATCCTCAAGCCTCGGCCGCGCTGGACGGGGAAGCAGATCATCAGCATGGTCATCCCGCAGGAA
ATCAGCCTGCACACCCCCGAGGGTGACTCTGACATTCCGCTGAAGGACACCGGTCTTCTCATCCAGAGCGGCCAG
CTCATGTATGGTCTGCTGAAGAAGAAGAACATTGGTTCTGCCGCGGGTGGCATAGTGCATCTCTGCTACAACGAG
CTGGGACCCGATGGGGCCATGGCCTTCCTCAACGGCGTACAGCAAGTCGTCACGTACTGGCTCCTGCACAACGGA
CATAGTATTGGCATTGGCGACACGGTCCCCGACAAGCAGACCATCGAGAAGGTCCAAGTCCACATCGACGTCCAG
AAGGCCGAGGTGGCCAGGCTGACGGCGCAGGCCACCGCCAACGAGCTTGAGGCCCTTCCCGGCATGAACGTCCGA
GCTACCTTCGAGAACAAAGTCTCCATGGCCCTTAACCAGGCCCGTGATCAAGCTGGTACTACGACGCAGAAGAGC
TTGAAGGACTCGAACAACGCTGTCACGATGGCCGAGTCCGGCTCCAAGGGCTCGTCCATCAACATTTCCCAGATG
ACCGCTCTGGTCGGGCAACAAATCGTCGAAGGCAAACGCATCCCGTTCGGCTTCAAGTACAGGACGCTCCCGCAC
TTCACCAAGGACGATTACTCGCCGGAGGCCCGTGGCTTTGTCGAGAACTCGTATCTCCGCGGCCTCACGCCCTCG
GAATTCTTCTTCCACGCCATGGCCGGTCGAGAAGGTCTCATTGACACTGCTGTCAAGACTGCAGAAACCGGATAC
ATCCAGCGTCGGCTTGTGAAAGCCCTCGAAGACCTCAGCGCCCGTTACGACGGTACTGTCCGGAACTCCCTTGGC
GACATCGTGCAGTTCCTATACGGTGAGGACGGTCTGGACGCTATGTGCATTGAGAAGCAGAAGCTCGGAGTCCTC
AAGATGTCGGATCCTGCATTTGAGAAGAAGTATCGTTTGGACCTGGCGAATCCACCCGAGTGGTTCCGGACGGAC
TACGAGTACGGCAATGAGTTGACAGGAGACAAAGCTTCCATGGCCCTCCTGGACGAGGAGTGGGAAGCTCTCCTG
CGTGACCGACGTGAAGTTCGCCTGATCAATAAGTCCAAGATGGGAGAGGAGATGATGCAGCTCCCACTCAATATT
GGCCGTATAATCGAGACGGCTAAGCGGGTCTTCAACGTCAAGGCGACGGATCGCAGTAACCTTCGCCCGTCAGAC
GTCATCCCGGCCGTCCAGAAGGTTCTCGCCAACATGAAGATCGTGCGAGGCCCGGATCCGATATCCTGGGAGGCG
GACGCCAATGCCACCATCCTGATCAAGGCCCTGCTGCGATCCCGGCTTGCGTTCAAGGAGATTGTCAAGGAACAC
CGCCTGAACAGGCTGGCCTTCGACCACGTGCTGGGAGAGCTGCAGAACCGCTGGGACCGGTCTTTCGTCAGCCCC
GGCGAAATGGTTGGTGTTCTCGCGGCGCAGTCGATTGGTGAGCCGGCAACGCAGATGACGCTCAACACTTTCCAC
TTTGCTGGTGTCTCGTCCAAGAACGTGACGCTCGGTGTGCCTCGACTCAAGGAGATTCTCAACCTGGCAAAGGAC
ATCAAAACCCCCAGCATGGCCGTCTACTTGAACACGACCTTGGGCAAGCAGGAAGAGGCGAAGAAGCTGCGAAGC
ATGGTGGAGTACACCAATCTGAGATCCATCACGTCCGTGACCGAGATTTACTACGATCCTGATATCCAGGGCACC
AGCATAGCCGAGGATGTCGACATGGTCGAGTCCTACTTTTTGATCCCCGACGACAGCCAGGACACCCTTGAACAA
CAGTCGAGGTGGCTCCTGCGCATCACGCTGGATCGTCAGAAGTTGCTGGATAAGGAGATCAAGATCGACGACGTT
GCCCAGCGAATCAAGGAGGAATACCCCCACGACCTGGGCATCATTTTCAGCGACAACAACGCGGATGAGCAGGTG
ATCCGCATCCGAACCATCAGGCAGGACGATGAGAAGGACGAGAATGGCGAGAAGCGTATCGAGGACGACGTCATG
CTCAAACGCCTCGAGTCTCATCTGCTGGACACCCTGACCCTTCGTGGCGTGCCGGGCATCGAACGGGCTTTTCTC
ACCAAGGGTACCCGCCTCGTCGAGGGCCCGGATGGAGCAGAGCTAGCCATCAAGGACGATCCGCGATGCACACAG
TGGTACCTGGACACCAGCGGTTCGGCCCTGCGCGAGGTACTCGCCGTCGACGGCGTCGATCCGACGCGGACGTAC
ACCAACGACCTGTGGCAGATCGTCGAGGTCTTTGGCATCGAGGCGGCGCGATCGGCGCTGGTCAAGGAATTGACG
AATGTGTTGGCCTTTGACGGCTCGTACGTCAACCACCGGCACATTGCGCTGCTGACGGACGTCATGACGTACCGC
GGCACCATCTCGGCCGTGACGCGCCACGGCATCAACCGGGCGGACACGGGCGCGCTGATGCGCTGCTCCTTCGAG
GAAACGGTAGAAATCCTGCTCGAGGCCGCCGCCACGGGCGAGCTCGACGACTGTCGCGGCATTTCCGAAAATGTC
ATGCTCGGGCAGATGGCGCCCATGGGGACGGGCAACTTCGACGTTCTGCTCGACCCAAAGATGCTGGAAACGGTC
ATCTCGGACAACTCGCGCATGGGCCTCATGCCAGGAATGCCGACCAAGGATGGCGAGGCGGAGGGAGCGGCAACA
CCGTACGACACGGGATCGCCCATGGCGGACTCGGGCTACATGAGCCTCAGCTCGCCGGCGGCCGGAAACTTCTCC
CCCATCCAGGGCGCTGGGTCGGAGACGCCGGCCGGGTTCGGGACGGAGTACGGCGGCATCGGCTTCGGCGGCATA
GGATCCATGAGCCCCTACGCGCGCGGAGCCACGAGCCCGTTCAGCACGTCGCCGACGTCGCCGTTCAGCGGCATG
GGCGGATACTCGCCGTCGTCGCCCAACGCGGGCTACTCGCCGACGTCGCCGCTGATCGACGGTGGCGGCGGGCGC
TACGCCACGTCGCCGTCGTTCAGCCCCTCCTCGCCGTCGTTCTCGCCGACTTCGCCGATGCTGCGGCCGACCAGC
CCGGCCAGTCCCAACTACAGCCCGACGTCGCCGAGCTATTCGCCTGCATCTCCGTCGTCCCCAAGGCACTACTCG
CCGACGTCGCCGGCGCAGTTCAACTCGCCGACGTCTCCGAGCTATTCGCCGGCCAGCCCCAACTACAGCCCGGCG
TCGCCCAACCTGCACGGGGCCGGACCGACGTCTCCCTCGTACTCGCCGGCCTCTCCCTCGTGGTCACCGACGTCC
CCGGAGGCCTACTCGCCCACGAGCCCGGGATTCTCGAGGAGCCCGGGGACGCAGCAGTCGCCGACGAGCCCCAGC
TACTCCCCGACGTCTCCGTCTTTTTCTCCCCGGACGCCCGGTCCGGGCAACTCGGGCAATCAGTATTCTCCAAAC
TCGCCGGCCAACGACTGA
Gene >Hirsu2|4522
ATGGCGAACCTTTACTTCACCCACTCGAGCGCGCCGCTCAAGACGGTAGAGGAGATTCAGTTCGGGCTCATGTCT
CCCGAGGAGATCAAGAATATGAGTGTCGCCCACATCCTCTATCCGGAGACAATGGAGGAGAACAAGACAAAGCCG
CGAGATGGAGGCCTCAACGACCCGCTGCTCGGGTCCATAGACCGCCAGTTCAAGTGCAAGACCTGTACGCAGGCC
ATGGGCGAATGCCCCGGCCACTTTGGCCACATCGAACTGGCCAAGCCAGTCTACCACCCAGGTTTCATCAAGAAG
GTCAAGAAGATCTTGGAGATTGTCTGCCATAACTGCAGCAAGGTGTTGGCCGATACTGTTCGTCTACGCTGCGCT
CTTCAAGATTCTTTGGTGACTTTCTGGGTGCTGACCTGATGTTCCTGCAGAGTGACCCCGAGTTCGTCACTGCCA
TCAACACCAGGGACCCCAAGCTTCGCTTCAACCGCGTCTGGACGGTTTGCAAGAAGAAGAGGAGATGCGAGAACG
AGGACCGTCAAAGCAAGGATAAGGATGAGGAGTTCGCGCCCGGCATGAAACTGCCCAACGCCGTCGACAACCACG
GCGGCTGCGGCAACGTTCAGCCCGCCGTCCGGCAGGCCGCGCTGCAGCTCAAGGCGGCCTTCGAAGTCGCCCAGG
AAGACGGACCCAAGCGTAAGGAAACCGTCCCCATCACGCCCGAGATGGCCCACGGCATCCTCCGACGCATTTCCG
AGGACGACTTGCGCAACATGGGCCTCAACTGCGACTACGCGCGCCCCGAATGGATGATCGTCACCGTCCTGCCGG
TGCCCCCCCCGCCCGTTCGCCCCAGCATCTCCATGGACGGCACCGGAACCGGAATGCGGAACGAAGATGATTTGA
CCTACAAGCTCGGCGACATCATCCGCGCCAACGGCAACGTGAAGCAAGCCATCCGCGAGGGCTCCCCTCAGCACA
TCGCCAGGGATTTTGAAGAGCTGCTCCAGTACCACGTCGCCACGTACATGGACAACGACATCGCGGGCCAGCCCC
GCGCGCTGCAGAAGAGCGGACGACCCGTCAAGGCCATCCGGGCTCGCTTAAAGGGAAAGGAGGGCCGTCTGCGAG
GCAACTTGATGGGGAAGCGTGTCGACTTCTCTGCCCGTACCGTCATCACCGGAGATGCCAACATTTCGCTCCACG
AAGTCGGCGTCCCTCGCAGCATTGCAAGGACCCTCACTTACCCGGAGACCGTCACCCCCTACAACATCGGCAAGC
TGCATCAGCTGGTGGAAAACGGTCCGAACGAGCATCCCGGCGCCAAGTACGTGATCCGCTCCGACGGCACGCGTA
TCGATCTCCGCCACCACAGACGCGCGGCACAGATCTCGCTGGAGTACGGGTGGAAAGTCGAGCGTCACCTCATGG
ATGGCGACTACATCATCTTCAATCGTCAACCATCGCTGCACAAAGAGTCGATGATGGGTCACCGCGTCCGCGTCA
TGCCTTACTCTACGTTTCGGCTGAACCTGTCCGTCACCTCGCCGTACAATGCCGATTTCGATGGTGACGAGATGA
ATCTGCACGTCCCTCAGAGCGAGGAAACTCGCGCCGAGATCAAGGAGCTATGCCTGGTTCCGAACAACATCGTCT
CCCCGCAGAAGAACGGTCCCCTGATGGGCATCGTCCAGGACTCCCTGGCTGGAGCCTACAAACTCTGCCGACGAG
ACACCTTCATCGACAAAGAGATGGTGATGAACCTCATGCTTTGGGTCCCGCACTGGGACGGCGTCATCCCCCCCC
CAGCCATCCTCAAGCCTCGGCCGCGCTGGACGGGGAAGCAGATCATCAGCATGGTCATCCCGCAGGAAATCAGCC
TGCACACCCCCGAGGGTGACTCTGACATTCCGCTGAAGGACACCGGTCTTCTCATCCAGAGCGGCCAGCTCATGT
ATGGTCTGCTGAAGAAGAAGAACATTGGTTCTGCCGCGGGTGGCATAGTGCATCTCTGCTACAACGAGCTGGGAC
CCGATGGGGCCATGGCCTTCCTCAACGGCGTACAGCAAGTCGTCACGTACTGGCTCCTGCACAACGGACATAGTA
TTGGCATTGGCGACACGGTCCCCGACAAGCAGACCATCGAGAAGGTCCAAGTCCACATCGACGTCCAGAAGGCCG
AGGTGGCCAGGCTGACGGCGCAGGCCACCGCCAACGAGCTTGAGGCCCTTCCCGGCATGAACGTCCGAGCTACCT
TCGAGAACAAAGTCTCCATGGCCCTTAACCAGGCCCGTGATCAAGCTGGTACTACGACGCAGAAGAGCTTGAAGG
ACTCGAACAACGCTGTCACGATGGCCGAGTCCGGCTCCAAGGGCTCGTCCATCAACATTTCCCAGATGACCGCTC
TGGTCGGGCAACAAATCGTCGAAGGCAAACGCATCCCGTTCGGCTTCAAGTACAGGACGCTCCCGCACTTCACCA
AGGACGATTACTCGCCGGAGGCCCGTGGCTTTGTCGAGAACTCGTATCTCCGCGGCCTCACGCCCTCGGAATTCT
TCTTCCACGCCATGGCCGGTCGAGAAGGTCTCATTGACACTGCTGTCAAGACTGCAGAAACCGGATACATCCAGC
GTCGGCTTGTGAAAGCCCTCGAAGACCTCAGCGCCCGTTACGACGGTACTGTCCGGAACTCCCTTGGCGACATCG
TGCAGTTCCTATACGGTGAGGACGGTCTGGACGCTATGTGCATTGAGAAGCAGAAGCTCGGAGTCCTCAAGATGT
CGGATCCTGCATTTGAGAAGAAGTATCGTTTGGACCTGGCGAATCCACCCGAGTGGTTCCGGACGGACTACGAGT
ACGGCAATGAGTTGACAGGAGACAAAGCTTCCATGGCCCTCCTGGACGAGGAGTGGGAAGCTCTCCTGCGTGACC
GACGTGAAGTTCGCCTGATCAATAAGTCCAAGATGGGAGAGGAGATGATGCAGCTCCCACTCAATATTGGCCGTA
TAATCGAGACGGCTAAGCGGGTCTTCAACGTCAAGGCGACGGATCGCAGTAACCTTCGCCCGTCAGACGTCATCC
CGGCCGTCCAGAAGGTTCTCGCCAACATGAAGATCGTGCGAGGCCCGGATCCGATATCCTGGGAGGCGGACGCCA
ATGCCACCATCCTGATCAAGGCCCTGCTGCGATCCCGGCTTGCGTTCAAGGAGATTGTCAAGGAACACCGCCTGA
ACAGGCTGGCCTTCGACCACGTGCTGGGAGAGCTGCAGAACCGCTGGGACCGGTCTTTCGTCAGCCCCGGCGAAA
TGGTTGGTGTTCTCGCGGCGCAGTCGATTGGTGAGCCGGCAACGCAGATGACGCTCAACACTTTCCACTTTGCTG
GTGTCTCGTCCAAGAACGTGACGCTCGGTGTGCCTCGACTCAAGGAGATTCTCAACCTGGCAAAGGACATCAAAA
CCCCCAGCATGGCCGTCTACTTGAACACGACCTTGGGCAAGCAGGAAGAGGCGAAGAAGCTGCGAAGCATGGTGG
AGTACACCAATCTGAGATCCATCACGTCCGTGACCGAGATTTACTACGATCCTGATATCCAGGGCACCAGCATAG
CCGAGGATGTCGACATGGTCGAGTCCTACTTTTTGATCCCCGACGACAGCCAGGACACCCTTGAACAACAGTCGA
GGTGGCTCCTGCGCATCACGCTGGATCGTCAGAAGTTGCTGGATAAGGAGATCAAGATCGACGACGTTGCCCAGC
GAATCAAGGAGGAATACCCCCACGACCTGGGCATCATTTTCAGCGACAACAACGCGGATGAGCAGGTGATCCGCA
TCCGAACCATCAGGCAGGACGATGAGAAGGACGAGAATGGCGAGAAGCGTATCGAGGACGACGTCATGCTCAAAC
GCCTCGAGTCTCATCTGCTGGACACCCTGACCCTTCGTGGCGTGCCGGGCATCGAACGGGCTTTTCTCACCAAGG
GTACCCGCCTCGTCGAGGGCCCGGATGGAGCAGAGCTAGCCATCAAGGACGATCCGCGATGCACACAGTGGTACC
TGGACACCAGCGGTTCGGCCCTGCGCGAGGTACTCGCCGTCGACGGCGTCGATCCGACGCGGACGTACACCAACG
ACCTGTGGCAGATCGTCGAGGTCTTTGGCATCGAGGCGGCGCGATCGGCGCTGGTCAAGGAATTGACGAATGTGT
TGGCCTTTGACGGCTCGTACGTCAACCACCGGCACATTGCGCTGCTGACGGACGTCATGACGTACCGCGGCACCA
TCTCGGCCGTGACGCGCCACGGCATCAACCGGGCGGACACGGGCGCGCTGATGCGCTGCTCCTTCGAGGAAACGG
TAGAAATCCTGCTCGAGGCCGCCGCCACGGGCGAGCTCGACGACTGTCGCGGCATTTCCGAAAATGTCATGCTCG
GGCAGATGGCGCCCATGGGGACGGGCAACTTCGACGTTCTGCTCGACCCAAAGATGCTGGAAACGGTCATCTCGG
ACAACTCGCGCATGGGCCTCATGCCAGGAATGCCGACCAAGGATGGCGAGGCGGAGGGAGCGGCAACACCGTACG
ACACGGGATCGCCCATGGCGGACTCGGGCTACATGAGCCTCAGCTCGCCGGCGGCCGGAAACTTCTCCCCCATCC
AGGGCGCTGGGTCGGAGACGCCGGCCGGGTTCGGGACGGAGTACGGCGGCATCGGCTTCGGCGGCATAGGATCCA
TGAGCCCCTACGCGCGCGGAGCCACGAGCCCGTTCAGCACGTCGCCGACGTCGCCGTTCAGCGGCATGGGCGGAT
ACTCGCCGTCGTCGCCCAACGCGGGCTACTCGCCGACGTCGCCGCTGATCGACGGTGGCGGCGGGCGCTACGCCA
CGTCGCCGTCGTTCAGCCCCTCCTCGCCGTCGTTCTCGCCGACTTCGCCGATGCTGCGGCCGACCAGCCCGGCCA
GTCCCAACTACAGCCCGACGTCGCCGAGCTATTCGCCTGCATCTCCGTCGTCCCCAAGGCACTACTCGCCGACGT
CGCCGGCGCAGTTCAACTCGCCGACGTCTCCGAGCTATTCGCCGGCCAGCCCCAACTACAGCCCGGCGTCGCCCA
ACCTGCACGGGGCCGGACCGACGTCTCCCTCGTACTCGCCGGCCTCTCCCTCGTGGTCACCGACGTCCCCGGAGG
CCTACTCGCCCACGAGCCCGGGATTCTCGAGGAGCCCGGGGACGCAGCAGTCGCCGACGAGCCCCAGCTACTCCC
CGACGTCTCCGTCTTTTTCTCCCCGGACGCCCGGTCCGGGCAACTCGGGCAATCAGTAGTGAGTATTAGCAGCGG
CCAGGAGCGCACCAGCAGGAGCTTGGGCATGAAGACGTAGGGGCTGACATTAAGGGCAATAGTTCTCCAAACTCG
CCGGCCAACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail