Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4520
Gene name
LocationContig_23:18181..19015
Strand-
Gene length (bp)834
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 2.5E-35 16 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 17 199 2.0E-84
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 17 199 8.0E-83
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 17 199 5.0E-79
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 17 199 7.0E-78
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 17 199 9.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 17 199 2.0E-84
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 17 199 8.0E-83
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 17 199 5.0E-79
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 17 199 7.0E-78
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 17 199 9.0E-77
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 17 199 8.0E-76
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 17 199 1.0E-75
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 17 199 3.0E-75
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 17 199 1.0E-74
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 17 198 7.0E-67
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 18 180 6.0E-38
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 17 177 5.0E-37
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 17 175 6.0E-37
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 17 189 9.0E-37
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 18 180 1.0E-36
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 18 177 2.0E-36
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 17 186 3.0E-36
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 18 191 3.0E-36
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 18 180 3.0E-36
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 18 175 7.0E-36
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 18 174 7.0E-36
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 18 180 7.0E-36
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 17 180 8.0E-36
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 17 197 1.0E-35
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 18 180 1.0E-35
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 17 197 1.0E-35
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 18 180 1.0E-35
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 18 175 1.0E-35
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 18 180 1.0E-35
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 18 175 2.0E-35
sp|P12078|HSP73_PLAFA Heat shock 70 kDa protein PPF203 (Fragment) OS=Plasmodium falciparum PE=3 SV=1 18 177 2.0E-35
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 17 177 2.0E-35
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 18 175 2.0E-35
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 18 180 2.0E-35
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 18 180 2.0E-35
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 17 175 2.0E-35
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 17 177 3.0E-35
sp|P11503|HSP70_ONCVO Heat shock 70 kDa protein (Fragment) OS=Onchocerca volvulus PE=2 SV=2 17 152 3.0E-35
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 17 197 3.0E-35
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 17 197 3.0E-35
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 17 190 3.0E-35
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 17 190 3.0E-35
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 18 180 4.0E-35
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 18 174 4.0E-35
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 17 197 5.0E-35
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 17 197 5.0E-35
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 18 175 6.0E-35
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 17 175 7.0E-35
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 17 175 8.0E-35
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 18 174 8.0E-35
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 18 174 8.0E-35
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 18 174 8.0E-35
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 18 174 8.0E-35
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 18 174 8.0E-35
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 17 190 8.0E-35
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 17 190 8.0E-35
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 18 174 1.0E-34
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 17 175 1.0E-34
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 18 174 1.0E-34
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 18 174 2.0E-34
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 17 177 2.0E-34
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 18 197 2.0E-34
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 17 175 4.0E-34
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 18 172 5.0E-34
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 17 175 6.0E-34
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 17 175 7.0E-34
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 18 186 8.0E-34
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 18 175 9.0E-34
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 17 175 3.0E-33
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 17 180 3.0E-33
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 17 180 3.0E-33
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 17 180 3.0E-33
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 17 177 3.0E-33
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 17 197 3.0E-33
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 18 180 4.0E-33
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 18 175 4.0E-33
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 18 197 4.0E-33
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 17 177 4.0E-33
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 17 177 4.0E-33
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 17 177 4.0E-33
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 18 180 5.0E-33
sp|P12794|GRP78_PLAFA 78 kDa glucose-regulated protein homolog (Fragment) OS=Plasmodium falciparum PE=2 SV=1 17 186 5.0E-33
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 3 191 5.0E-33
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 18 174 8.0E-33
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 17 177 9.0E-33
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 17 177 9.0E-33
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 17 177 9.0E-33
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 17 177 9.0E-33
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 17 177 9.0E-33
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 18 178 1.0E-32
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 18 175 2.0E-32
sp|Q92260|HSP70_PENCI Heat shock 70 kDa protein (Fragment) OS=Penicillium citrinum GN=HSP70 PE=1 SV=1 17 150 2.0E-32
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 17 180 2.0E-32
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 18 178 2.0E-32
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 17 177 4.0E-32
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 17 177 4.0E-32
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 17 177 9.0E-32
sp|P27894|HSP70_LEIBR Heat shock 70 kDa protein (Fragment) OS=Leishmania braziliensis GN=HSP70 PE=2 SV=1 18 178 9.0E-32
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 17 175 1.0E-31
sp|Q05866|GRP78_PLAFO 78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1 17 186 1.0E-31
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 17 197 2.0E-31
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 18 175 3.0E-31
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 18 198 3.0E-31
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 17 177 3.0E-31
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 17 197 4.0E-31
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 17 177 4.0E-31
sp|P16121|HSP70_LUPPO Heat shock 70 kDa protein (Fragment) OS=Lupinus polyphyllus PE=2 SV=2 3 175 6.0E-31
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 18 198 7.0E-31
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 18 188 7.0E-31
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 18 186 8.0E-31
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 17 177 1.0E-30
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 17 177 1.0E-30
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 17 177 1.0E-30
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 17 177 1.0E-30
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 17 177 2.0E-30
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 17 177 2.0E-30
sp|Q03686|BIP8_TOBAC Luminal-binding protein 8 (Fragment) OS=Nicotiana tabacum GN=BIP8 PE=2 SV=1 18 177 2.0E-30
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 17 143 2.0E-30
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 17 143 2.0E-30
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 17 143 2.0E-30
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 17 175 3.0E-30
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 17 143 3.0E-30
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 17 177 3.0E-30
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 17 177 3.0E-30
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 17 197 4.0E-30
sp|Q03681|BIP1_TOBAC Luminal-binding protein 1 (Fragment) OS=Nicotiana tabacum GN=BIP1 PE=2 SV=1 18 177 4.0E-30
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 17 177 4.0E-30
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 17 177 4.0E-30
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 18 198 5.0E-30
sp|Q03682|BIP2_TOBAC Luminal-binding protein 2 (Fragment) OS=Nicotiana tabacum GN=BIP2 PE=2 SV=1 3 177 5.0E-30
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 18 197 9.0E-30
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 18 177 1.0E-29
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 17 197 1.0E-29
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 17 177 1.0E-29
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 18 135 2.0E-29
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 18 178 2.0E-29
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 13 185 2.0E-29
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 17 177 3.0E-29
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 3 184 3.0E-29
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 18 178 3.0E-29
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 17 184 4.0E-29
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 17 177 4.0E-29
sp|P34935|GRP78_PIG 78 kDa glucose-regulated protein (Fragment) OS=Sus scrofa GN=HSPA5 PE=2 SV=2 18 172 4.0E-29
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 17 177 6.0E-29
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 18 145 7.0E-29
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 18 192 8.0E-29
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 18 180 8.0E-29
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 18 178 9.0E-29
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 18 197 1.0E-28
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 18 197 1.0E-28
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 18 197 1.0E-28
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 18 197 1.0E-28
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 18 197 1.0E-28
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 18 177 1.0E-28
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 18 197 1.0E-28
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 18 135 2.0E-28
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 18 135 2.0E-28
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 17 198 2.0E-28
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 3 180 3.0E-28
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 18 197 6.0E-28
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 17 172 8.0E-28
sp|C1DD88|DNAK_LARHH Chaperone protein DnaK OS=Laribacter hongkongensis (strain HLHK9) GN=dnaK PE=3 SV=1 17 187 9.0E-28
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 19 197 1.0E-27
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 3 197 2.0E-27
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 17 197 5.0E-27
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 3 197 6.0E-27
sp|Q9HHB9|DNAK_HALMT Chaperone protein DnaK OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=dnaK PE=3 SV=1 18 181 8.0E-27
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 18 179 8.0E-27
sp|A4J7F3|DNAK_DESRM Chaperone protein DnaK OS=Desulfotomaculum reducens (strain MI-1) GN=dnaK PE=3 SV=1 18 186 2.0E-26
sp|P34934|HSP7X_PIG Heat shock 70 kDa protein (Fragment) OS=Sus scrofa PE=2 SV=1 21 161 2.0E-26
sp|Q1IT15|DNAK_KORVE Chaperone protein DnaK OS=Koribacter versatilis (strain Ellin345) GN=dnaK PE=3 SV=1 17 176 2.0E-26
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 17 180 3.0E-26
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 13 178 4.0E-26
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 13 178 4.0E-26
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 13 178 4.0E-26
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 13 172 5.0E-26
sp|C1CZH9|DNAK_DEIDV Chaperone protein DnaK OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=dnaK PE=3 SV=1 18 135 6.0E-26
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 17 189 6.0E-26
sp|B9MDJ7|DNAK_ACIET Chaperone protein DnaK OS=Acidovorax ebreus (strain TPSY) GN=dnaK PE=3 SV=1 17 180 6.0E-26
sp|Q182E8|DNAK_PEPD6 Chaperone protein DnaK OS=Peptoclostridium difficile (strain 630) GN=dnaK PE=3 SV=1 18 183 7.0E-26
sp|A1WAR6|DNAK_ACISJ Chaperone protein DnaK OS=Acidovorax sp. (strain JS42) GN=dnaK PE=3 SV=1 17 180 8.0E-26
sp|P94695|DNAK_DEIPM Chaperone protein DnaK OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaK PE=3 SV=2 18 133 9.0E-26
sp|B1Y786|DNAK_LEPCP Chaperone protein DnaK OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaK PE=3 SV=1 17 181 1.0E-25
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 13 172 2.0E-25
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 13 172 2.0E-25
sp|A6LRN4|DNAK_CLOB8 Chaperone protein DnaK OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaK PE=3 SV=1 18 141 2.0E-25
sp|A1U614|DNAK_MARHV Chaperone protein DnaK OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaK PE=3 SV=1 18 186 3.0E-25
sp|Q08080|HSP7S_SPIOL Stromal 70 kDa heat shock-related protein, chloroplastic (Fragment) OS=Spinacia oleracea GN=CHSP70 PE=2 SV=1 3 171 3.0E-25
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 18 177 3.0E-25
sp|Q8XW40|DNAK_RALSO Chaperone protein DnaK OS=Ralstonia solanacearum (strain GMI1000) GN=dnaK PE=3 SV=2 17 187 4.0E-25
sp|Q0SRE3|DNAK_CLOPS Chaperone protein DnaK OS=Clostridium perfringens (strain SM101 / Type A) GN=dnaK PE=3 SV=1 13 164 4.0E-25
sp|B5ZWQ2|DNAK_RHILW Chaperone protein DnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=3 SV=1 17 182 4.0E-25
sp|Q9RY23|DNAK_DEIRA Chaperone protein DnaK OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaK PE=1 SV=3 18 142 4.0E-25
sp|P26823|DNAK_CLOPE Chaperone protein DnaK OS=Clostridium perfringens (strain 13 / Type A) GN=dnaK PE=3 SV=2 13 164 5.0E-25
sp|Q0TNS7|DNAK_CLOP1 Chaperone protein DnaK OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dnaK PE=3 SV=1 13 164 5.0E-25
sp|Q1MN11|DNAK_RHIL3 Chaperone protein DnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=3 SV=1 17 182 6.0E-25
sp|A1TLH9|DNAK_ACIAC Chaperone protein DnaK OS=Acidovorax citrulli (strain AAC00-1) GN=dnaK PE=3 SV=1 17 178 6.0E-25
sp|A0Q1R4|DNAK_CLONN Chaperone protein DnaK OS=Clostridium novyi (strain NT) GN=dnaK PE=3 SV=1 13 161 6.0E-25
sp|O33528|DNAK_RHILE Chaperone protein DnaK OS=Rhizobium leguminosarum GN=dnaK PE=3 SV=1 17 182 7.0E-25
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 17 145 7.0E-25
sp|A0QQC8|DNAK_MYCS2 Chaperone protein DnaK OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dnaK PE=1 SV=1 17 178 7.0E-25
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 3 178 8.0E-25
sp|Q3AF08|DNAK_CARHZ Chaperone protein DnaK OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaK PE=3 SV=1 18 145 8.0E-25
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 17 145 9.0E-25
sp|B6IZJ0|DNAK_COXB2 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaK PE=3 SV=1 17 186 1.0E-24
sp|C1F2D2|DNAK_ACIC5 Chaperone protein DnaK OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=dnaK PE=3 SV=1 17 172 1.0E-24
sp|Q02028|HSP7S_PEA Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1 3 171 1.0E-24
sp|B2UBP3|DNAK_RALPJ Chaperone protein DnaK OS=Ralstonia pickettii (strain 12J) GN=dnaK PE=3 SV=1 17 187 1.0E-24
sp|A0RZ01|DNAK_CENSY Chaperone protein DnaK OS=Cenarchaeum symbiosum (strain A) GN=dnaK PE=3 SV=1 18 192 1.0E-24
sp|A9BNG5|DNAK_DELAS Chaperone protein DnaK OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaK PE=3 SV=1 17 186 2.0E-24
sp|B9LUC7|DNAK_HALLT Chaperone protein DnaK OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaK PE=3 SV=1 18 138 2.0E-24
sp|Q2SSB0|DNAK_MYCCT Chaperone protein DnaK OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=dnaK PE=3 SV=1 18 140 2.0E-24
sp|B3PXH3|DNAK_RHIE6 Chaperone protein DnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=3 SV=1 17 182 2.0E-24
sp|A0RPW7|DNAK_CAMFF Chaperone protein DnaK OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=dnaK PE=3 SV=1 17 166 2.0E-24
sp|Q826F6|DNAK2_STRAW Chaperone protein dnaK2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaK2 PE=3 SV=1 13 172 2.0E-24
sp|Q2KDW6|DNAK_RHIEC Chaperone protein DnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=3 SV=1 17 182 3.0E-24
sp|O87712|DNAK_COXBU Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaK PE=1 SV=1 17 178 3.0E-24
sp|A9N8H2|DNAK_COXBR Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaK PE=3 SV=1 17 178 3.0E-24
sp|A9KG88|DNAK_COXBN Chaperone protein DnaK OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaK PE=3 SV=1 17 178 3.0E-24
sp|B6J7U7|DNAK_COXB1 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaK PE=3 SV=1 17 178 3.0E-24
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 18 197 4.0E-24
sp|B1ILM3|DNAK_CLOBK Chaperone protein DnaK OS=Clostridium botulinum (strain Okra / Type B1) GN=dnaK PE=3 SV=1 13 164 4.0E-24
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 18 196 4.0E-24
sp|C3L3G7|DNAK_CLOB6 Chaperone protein DnaK OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dnaK PE=3 SV=1 13 161 5.0E-24
sp|Q128K2|DNAK_POLSJ Chaperone protein DnaK OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dnaK PE=3 SV=1 17 178 5.0E-24
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 13 190 5.0E-24
sp|C5CU12|DNAK_VARPS Chaperone protein DnaK OS=Variovorax paradoxus (strain S110) GN=dnaK PE=3 SV=1 17 172 5.0E-24
sp|A5N6M2|DNAK_CLOK5 Chaperone protein DnaK OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaK PE=3 SV=1 18 162 5.0E-24
sp|B9E041|DNAK_CLOK1 Chaperone protein DnaK OS=Clostridium kluyveri (strain NBRC 12016) GN=dnaK PE=3 SV=1 18 162 5.0E-24
sp|Q11QH3|DNAK_CYTH3 Chaperone protein DnaK OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=dnaK PE=3 SV=1 18 180 6.0E-24
sp|A7GHH6|DNAK_CLOBL Chaperone protein DnaK OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dnaK PE=3 SV=1 13 164 6.0E-24
sp|C1FVU0|DNAK_CLOBJ Chaperone protein DnaK OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dnaK PE=3 SV=1 13 164 6.0E-24
sp|A5I640|DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dnaK PE=3 SV=1 13 164 6.0E-24
sp|A7FXL5|DNAK_CLOB1 Chaperone protein DnaK OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dnaK PE=3 SV=1 13 164 6.0E-24
sp|Q9K0N4|DNAK_NEIMB Chaperone protein DnaK OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaK PE=1 SV=1 17 187 6.0E-24
sp|A1KSG3|DNAK_NEIMF Chaperone protein DnaK OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaK PE=3 SV=1 17 187 6.0E-24
sp|Q5F6W5|DNAK_NEIG1 Chaperone protein DnaK OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaK PE=3 SV=1 17 187 6.0E-24
sp|Q9JVQ9|DNAK_NEIMA Chaperone protein DnaK OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaK PE=3 SV=1 17 187 7.0E-24
sp|B1KZN7|DNAK_CLOBM Chaperone protein DnaK OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dnaK PE=3 SV=1 13 145 7.0E-24
sp|A9M296|DNAK_NEIM0 Chaperone protein DnaK OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaK PE=3 SV=1 17 187 7.0E-24
sp|Q6MT06|DNAK_MYCMS Chaperone protein DnaK OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=dnaK PE=3 SV=1 18 140 7.0E-24
sp|Q1RHH0|DNAK_RICBR Chaperone protein DnaK OS=Rickettsia bellii (strain RML369-C) GN=dnaK PE=3 SV=1 18 177 8.0E-24
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 3 171 8.0E-24
sp|Q824B2|DNAK_CHLCV Chaperone protein DnaK OS=Chlamydophila caviae (strain GPIC) GN=dnaK PE=3 SV=1 18 145 1.0E-23
sp|B1H009|DNAK_UNCTG Chaperone protein DnaK OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=dnaK PE=3 SV=1 18 145 1.0E-23
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 18 187 1.0E-23
sp|B6JCI3|DNAK_OLICO Chaperone protein DnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=3 SV=1 17 187 1.0E-23
sp|Q0AIY1|DNAK_NITEC Chaperone protein DnaK OS=Nitrosomonas eutropha (strain C91) GN=dnaK PE=3 SV=1 18 186 1.0E-23
sp|Q7MA35|DNAK_WOLSU Chaperone protein DnaK OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaK PE=3 SV=1 17 166 1.0E-23
sp|B8GNX1|DNAK_THISH Chaperone protein DnaK OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaK PE=3 SV=1 17 187 1.0E-23
sp|B1MIX5|DNAK_MYCA9 Chaperone protein DnaK OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=dnaK PE=3 SV=1 17 178 1.0E-23
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 17 187 1.0E-23
sp|A5EYG3|DNAK_DICNV Chaperone protein DnaK OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaK PE=3 SV=1 18 164 2.0E-23
sp|P12795|HSP70_SCHJA Heat shock 70 kDa protein (Fragment) OS=Schistosoma japonicum PE=2 SV=1 36 136 2.0E-23
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 3 171 2.0E-23
sp|Q01100|DNAK_HALMA Chaperone protein DnaK OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dnaK PE=3 SV=2 18 143 2.0E-23
sp|Q5YNI0|DNAK_NOCFA Chaperone protein DnaK OS=Nocardia farcinica (strain IFM 10152) GN=dnaK PE=3 SV=1 17 145 2.0E-23
sp|A6QBG0|DNAK_SULNB Chaperone protein DnaK OS=Sulfurovum sp. (strain NBC37-1) GN=dnaK PE=3 SV=1 18 166 2.0E-23
sp|B3R6G7|DNAK_CUPTR Chaperone protein DnaK OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaK PE=3 SV=1 17 164 2.0E-23
sp|A1VFG6|DNAK_DESVV Chaperone protein DnaK OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaK PE=3 SV=1 13 187 2.0E-23
sp|Q72DW8|DNAK_DESVH Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaK PE=3 SV=1 13 187 2.0E-23
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 18 191 2.0E-23
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 17 182 3.0E-23
sp|Q37106|DNAK_CYAPA Chaperone protein dnaK OS=Cyanophora paradoxa GN=dnaK-A PE=3 SV=2 18 172 3.0E-23
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 18 182 3.0E-23
sp|A0QLZ6|DNAK_MYCA1 Chaperone protein DnaK OS=Mycobacterium avium (strain 104) GN=dnaK PE=3 SV=1 17 171 3.0E-23
sp|Q00488|DNAK_MYCPA Chaperone protein DnaK OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaK PE=3 SV=4 17 171 3.0E-23
sp|Q7NXI3|DNAK_CHRVO Chaperone protein DnaK OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaK PE=3 SV=1 17 187 4.0E-23
sp|B3PF33|DNAK_CELJU Chaperone protein DnaK OS=Cellvibrio japonicus (strain Ueda107) GN=dnaK PE=3 SV=1 18 198 4.0E-23
sp|A7ZEB5|DNAK_CAMC1 Chaperone protein DnaK OS=Campylobacter concisus (strain 13826) GN=dnaK PE=3 SV=1 17 190 4.0E-23
sp|Q0W874|DNAK_METAR Chaperone protein DnaK OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=dnaK PE=3 SV=1 13 168 4.0E-23
sp|B8DRD6|DNAK_DESVM Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaK PE=3 SV=1 13 164 4.0E-23
sp|P29845|HSP7E_DROME Heat shock 70 kDa protein cognate 5 OS=Drosophila melanogaster GN=Hsc70-5 PE=1 SV=2 18 198 4.0E-23
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 18 187 4.0E-23
sp|A0KMI6|DNAK_AERHH Chaperone protein DnaK OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaK PE=3 SV=1 17 186 5.0E-23
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 13 183 5.0E-23
sp|A4G8D2|DNAK_HERAR Chaperone protein DnaK OS=Herminiimonas arsenicoxydans GN=dnaK PE=3 SV=1 17 187 5.0E-23
sp|Q46XI7|DNAK_CUPPJ Chaperone protein DnaK OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaK PE=3 SV=1 18 164 5.0E-23
sp|P0CS91|HSP77_YEASX Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1 3 162 5.0E-23
sp|P0CS90|HSP77_YEAST Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSC1 PE=1 SV=1 3 194 5.0E-23
sp|Q5PAB8|DNAK_ANAMM Chaperone protein DnaK OS=Anaplasma marginale (strain St. Maries) GN=dnaK PE=3 SV=1 18 194 5.0E-23
sp|Q05647|DNAK_ERYRH Chaperone protein DnaK OS=Erysipelothrix rhusiopathiae GN=dnaK PE=3 SV=2 18 141 5.0E-23
sp|P50022|DNAK3_SYNE7 Chaperone protein dnaK3 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK3 PE=3 SV=1 3 186 5.0E-23
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 18 145 5.0E-23
sp|Q12Q08|DNAK_SHEDO Chaperone protein DnaK OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaK PE=3 SV=1 18 172 5.0E-23
sp|A4T112|DNAK_MYCGI Chaperone protein DnaK OS=Mycobacterium gilvum (strain PYR-GCK) GN=dnaK PE=3 SV=1 17 171 6.0E-23
sp|A7GXU4|DNAK_CAMC5 Chaperone protein DnaK OS=Campylobacter curvus (strain 525.92) GN=dnaK PE=3 SV=1 17 166 6.0E-23
sp|Q5N1V0|DNAK1_SYNP6 Chaperone protein DnaK 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK1 PE=3 SV=1 3 186 6.0E-23
sp|A1SPX5|DNAK_NOCSJ Chaperone protein DnaK OS=Nocardioides sp. (strain BAA-499 / JS614) GN=dnaK PE=3 SV=1 18 182 6.0E-23
sp|B0TAD7|DNAK_HELMI Chaperone protein DnaK OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=dnaK PE=3 SV=1 3 192 6.0E-23
sp|C6E643|DNAK_GEOSM Chaperone protein DnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=3 SV=1 13 183 6.0E-23
sp|Q086J3|DNAK_SHEFN Chaperone protein DnaK OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaK PE=3 SV=1 18 186 7.0E-23
sp|A3QGW2|DNAK_SHELP Chaperone protein DnaK OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaK PE=3 SV=1 17 178 7.0E-23
sp|C0ZT86|DNAK_RHOE4 Chaperone protein DnaK OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=dnaK PE=3 SV=1 17 197 7.0E-23
sp|A2SIR4|DNAK_METPP Chaperone protein DnaK OS=Methylibium petroleiphilum (strain PM1) GN=dnaK PE=3 SV=1 17 172 7.0E-23
sp|P75344|DNAK_MYCPN Chaperone protein DnaK OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaK PE=3 SV=1 18 175 7.0E-23
sp|Q1IWL4|DNAK_DEIGD Chaperone protein DnaK OS=Deinococcus geothermalis (strain DSM 11300) GN=dnaK PE=3 SV=1 3 146 7.0E-23
sp|A8H760|DNAK_SHEPA Chaperone protein DnaK OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaK PE=3 SV=1 17 186 8.0E-23
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 18 178 8.0E-23
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 18 187 8.0E-23
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 18 175 8.0E-23
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 18 175 8.0E-23
sp|C4L8Y5|DNAK_TOLAT Chaperone protein DnaK OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaK PE=3 SV=1 18 186 8.0E-23
sp|P20442|DNAK_CAUCR Chaperone protein DnaK OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaK PE=2 SV=2 17 186 9.0E-23
sp|A0PLQ1|DNAK_MYCUA Chaperone protein DnaK OS=Mycobacterium ulcerans (strain Agy99) GN=dnaK PE=3 SV=1 17 171 1.0E-22
sp|B1KRT2|DNAK_SHEWM Chaperone protein DnaK OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaK PE=3 SV=1 17 186 1.0E-22
sp|Q8GH79|DNAK_CHLAB Chaperone protein DnaK OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaK PE=3 SV=2 18 145 1.0E-22
sp|Q0K757|DNAK_CUPNH Chaperone protein DnaK OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaK PE=3 SV=1 17 164 1.0E-22
sp|P50021|DNAK2_SYNE7 Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2 3 170 1.0E-22
sp|Q01PM8|DNAK_SOLUE Chaperone protein DnaK OS=Solibacter usitatus (strain Ellin6076) GN=dnaK PE=3 SV=1 18 141 1.0E-22
sp|Q7W519|DNAK_BORPA Chaperone protein DnaK OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaK PE=3 SV=1 13 166 1.0E-22
sp|Q7VVY2|DNAK_BORPE Chaperone protein DnaK OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaK PE=3 SV=1 13 166 1.0E-22
sp|Q7WGI4|DNAK_BORBR Chaperone protein DnaK OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaK PE=3 SV=1 13 166 1.0E-22
sp|B2HPS1|DNAK_MYCMM Chaperone protein DnaK OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=dnaK PE=3 SV=1 17 171 1.0E-22
sp|A1VMG2|DNAK_POLNA Chaperone protein DnaK OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaK PE=3 SV=1 17 178 1.0E-22
sp|Q97BG8|DNAK_THEVO Chaperone protein DnaK OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaK PE=3 SV=1 3 182 1.0E-22
sp|Q9L7Z1|DNAK_VIBPR Chaperone protein DnaK OS=Vibrio proteolyticus GN=dnaK PE=3 SV=1 18 186 2.0E-22
sp|B0TQC2|DNAK_SHEHH Chaperone protein DnaK OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaK PE=3 SV=1 17 186 2.0E-22
sp|O85282|DNAK_NEOSE Chaperone protein DnaK OS=Neorickettsia sennetsu GN=dnaK PE=3 SV=1 17 177 2.0E-22
sp|Q30Q10|DNAK_SULDN Chaperone protein DnaK OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=dnaK PE=3 SV=1 18 166 2.0E-22
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 17 194 2.0E-22
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 17 194 2.0E-22
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 17 194 2.0E-22
sp|O33522|DNAK_CUPMC Chaperone protein DnaK OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaK PE=3 SV=2 17 166 2.0E-22
sp|B9L8Z0|DNAK_NAUPA Chaperone protein DnaK OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=dnaK PE=3 SV=1 17 189 2.0E-22
sp|O05700|DNAK_RHOS7 Chaperone protein DnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=3 SV=1 18 187 2.0E-22
sp|P37900|HSP7M_PEA Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1 18 194 2.0E-22
sp|P42374|DNAK_RHIME Chaperone protein DnaK OS=Rhizobium meliloti (strain 1021) GN=dnaK PE=3 SV=2 18 182 2.0E-22
sp|Q5LWJ6|DNAK_RUEPO Chaperone protein DnaK OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaK PE=3 SV=1 18 147 2.0E-22
sp|Q892R0|DNAK_CLOTE Chaperone protein DnaK OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaK PE=3 SV=1 13 145 2.0E-22
sp|A1T2S3|DNAK_MYCVP Chaperone protein DnaK OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=dnaK PE=3 SV=1 17 171 2.0E-22
sp|Q9TLT1|DNAK_CYACA Chaperone protein dnaK OS=Cyanidium caldarium GN=dnaK PE=3 SV=1 3 175 2.0E-22
sp|A6WRU9|DNAK_SHEB8 Chaperone protein DnaK OS=Shewanella baltica (strain OS185) GN=dnaK PE=3 SV=1 18 186 2.0E-22
sp|A3D7T4|DNAK_SHEB5 Chaperone protein DnaK OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaK PE=3 SV=1 18 186 2.0E-22
sp|B8CKF3|DNAK_SHEPW Chaperone protein DnaK OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaK PE=3 SV=1 17 186 2.0E-22
sp|B8J402|DNAK_DESDA Chaperone protein DnaK OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=dnaK PE=3 SV=1 13 187 3.0E-22
sp|A9L0R8|DNAK_SHEB9 Chaperone protein DnaK OS=Shewanella baltica (strain OS195) GN=dnaK PE=3 SV=1 18 186 3.0E-22
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 17 186 3.0E-22
sp|Q5N0G0|DNAK3_SYNP6 Chaperone protein DnaK 3 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK3 PE=3 SV=1 18 190 3.0E-22
sp|Q8YUA6|DNAK3_NOSS1 Chaperone protein dnaK3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK3 PE=3 SV=1 18 145 3.0E-22
sp|Q2GF34|DNAK_NEOSM Chaperone protein DnaK OS=Neorickettsia sennetsu (strain Miyayama) GN=dnaK PE=3 SV=1 17 177 3.0E-22
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 17 187 3.0E-22
sp|P50020|DNAK1_SYNE7 Chaperone protein dnaK1 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK1 PE=3 SV=2 18 190 3.0E-22
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 18 145 3.0E-22
sp|Q145F1|DNAK_BURXL Chaperone protein DnaK OS=Burkholderia xenovorans (strain LB400) GN=dnaK PE=3 SV=1 17 166 3.0E-22
sp|Q4G366|DNAK_EMIHU Chaperone protein dnaK OS=Emiliania huxleyi GN=dnaK PE=3 SV=1 17 165 3.0E-22
sp|Q87RX3|DNAK_VIBPA Chaperone protein DnaK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaK PE=3 SV=1 18 186 3.0E-22
sp|Q9LTX9|HSP7G_ARATH Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana GN=HSP70-7 PE=2 SV=1 3 171 3.0E-22
sp|Q3SW76|DNAK_NITWN Chaperone protein DnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=3 SV=1 18 187 3.0E-22
sp|A6TSM0|DNAK_ALKMQ Chaperone protein DnaK OS=Alkaliphilus metalliredigens (strain QYMF) GN=dnaK PE=3 SV=1 17 140 3.0E-22
sp|A1RGN1|DNAK_SHESW Chaperone protein DnaK OS=Shewanella sp. (strain W3-18-1) GN=dnaK PE=3 SV=1 18 186 3.0E-22
sp|A4Y9Q3|DNAK_SHEPC Chaperone protein DnaK OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaK PE=3 SV=1 18 186 3.0E-22
sp|B0S1F8|DNAK_FINM2 Chaperone protein DnaK OS=Finegoldia magna (strain ATCC 29328) GN=dnaK PE=3 SV=1 18 164 4.0E-22
sp|B5FA11|DNAK_VIBFM Chaperone protein DnaK OS=Vibrio fischeri (strain MJ11) GN=dnaK PE=3 SV=1 17 186 4.0E-22
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 3 145 4.0E-22
sp|O52960|DNAK_APHHA Chaperone protein DnaK OS=Aphanothece halophytica GN=dnaK PE=2 SV=1 18 199 4.0E-22
sp|A9AGB8|DNAK_BURM1 Chaperone protein DnaK OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaK PE=3 SV=1 17 179 4.0E-22
sp|A1A3P5|DNAK_BIFAA Chaperone protein DnaK OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=dnaK PE=3 SV=1 18 145 4.0E-22
sp|Q6LS31|DNAK2_PHOPR Chaperone protein DnaK 2 OS=Photobacterium profundum GN=dnaK2 PE=3 SV=1 18 186 4.0E-22
sp|Q9ZFC6|DNAK_METSS Chaperone protein DnaK OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaK PE=3 SV=1 17 178 4.0E-22
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 17 194 4.0E-22
sp|Q7NAU6|DNAK_MYCGA Chaperone protein DnaK OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaK PE=3 SV=2 18 144 5.0E-22
sp|B9M357|DNAK_GEODF Chaperone protein DnaK OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dnaK PE=3 SV=1 13 178 5.0E-22
sp|B2KAX0|DNAK_ELUMP Chaperone protein DnaK OS=Elusimicrobium minutum (strain Pei191) GN=dnaK PE=3 SV=1 13 141 5.0E-22
sp|O69298|DNAK_CAMJE Chaperone protein DnaK OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaK PE=3 SV=1 18 188 5.0E-22
sp|Q5E3A7|DNAK2_VIBF1 Chaperone protein DnaK 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaK2 PE=3 SV=1 17 186 5.0E-22
sp|A6UEY0|DNAK_SINMW Chaperone protein DnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=3 SV=1 18 182 5.0E-22
sp|Q3IC08|DNAK_PSEHT Chaperone protein DnaK OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaK PE=3 SV=1 17 189 5.0E-22
sp|Q5HV33|DNAK_CAMJR Chaperone protein DnaK OS=Campylobacter jejuni (strain RM1221) GN=dnaK PE=3 SV=1 18 188 5.0E-22
sp|A8FLH2|DNAK_CAMJ8 Chaperone protein DnaK OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dnaK PE=3 SV=1 18 188 5.0E-22
sp|Q16D45|DNAK_ROSDO Chaperone protein DnaK OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaK PE=3 SV=1 18 141 5.0E-22
sp|Q1GKS3|DNAK_RUEST Chaperone protein DnaK OS=Ruegeria sp. (strain TM1040) GN=dnaK PE=3 SV=1 18 145 5.0E-22
sp|A9IGC3|DNAK_BORPD Chaperone protein DnaK OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaK PE=3 SV=1 17 187 5.0E-22
sp|A4SQ25|DNAK_AERS4 Chaperone protein DnaK OS=Aeromonas salmonicida (strain A449) GN=dnaK PE=3 SV=1 18 186 5.0E-22
sp|P50023|DNAK_THEAC Chaperone protein DnaK OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaK PE=3 SV=2 3 172 6.0E-22
sp|Q2KWA2|DNAK_BORA1 Chaperone protein DnaK OS=Bordetella avium (strain 197N) GN=dnaK PE=3 SV=1 17 186 6.0E-22
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 17 166 6.0E-22
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 13 183 6.0E-22
sp|O05714|DNAK_ANAVT Chaperone protein DnaK OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaK PE=3 SV=1 3 180 6.0E-22
sp|A8ALU3|DNAK_CITK8 Chaperone protein DnaK OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dnaK PE=3 SV=1 18 187 6.0E-22
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 18 136 6.0E-22
sp|Q3J7D8|DNAK_NITOC Chaperone protein DnaK OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaK PE=3 SV=1 13 171 6.0E-22
sp|Q21H36|DNAK_SACD2 Chaperone protein DnaK OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaK PE=3 SV=1 18 136 6.0E-22
sp|Q9ZEJ6|DNAK1_NOSS1 Chaperone protein dnaK1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK1 PE=3 SV=2 3 180 7.0E-22
sp|Q313S2|DNAK_DESAG Chaperone protein DnaK OS=Desulfovibrio alaskensis (strain G20) GN=dnaK PE=3 SV=1 17 183 7.0E-22
sp|B2JGE2|DNAK_BURP8 Chaperone protein DnaK OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaK PE=3 SV=1 17 166 7.0E-22
sp|A4WW89|DNAK_RHOS5 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=3 SV=1 18 136 7.0E-22
sp|A8FYU0|DNAK_SHESH Chaperone protein DnaK OS=Shewanella sediminis (strain HAW-EB3) GN=dnaK PE=3 SV=1 17 186 8.0E-22
sp|Q2Y6U0|DNAK_NITMU Chaperone protein DnaK OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dnaK PE=3 SV=1 17 187 8.0E-22
sp|Q3Z601|DNAK_SHISS Chaperone protein DnaK OS=Shigella sonnei (strain Ss046) GN=dnaK PE=3 SV=1 18 187 8.0E-22
sp|Q32KA5|DNAK_SHIDS Chaperone protein DnaK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaK PE=3 SV=1 18 187 8.0E-22
sp|Q326K7|DNAK_SHIBS Chaperone protein DnaK OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaK PE=3 SV=1 18 187 8.0E-22
sp|Q1RGI8|DNAK_ECOUT Chaperone protein DnaK OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaK PE=3 SV=1 18 187 8.0E-22
sp|P0A6Y8|DNAK_ECOLI Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2 18 187 8.0E-22
sp|B1IRG0|DNAK_ECOLC Chaperone protein DnaK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaK PE=3 SV=1 18 187 8.0E-22
sp|P0A6Y9|DNAK_ECOL6 Chaperone protein DnaK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaK PE=3 SV=2 18 187 8.0E-22
sp|Q0TLX5|DNAK_ECOL5 Chaperone protein DnaK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dnaK PE=3 SV=1 18 187 8.0E-22
sp|A1A766|DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC GN=dnaK PE=3 SV=1 18 187 8.0E-22
sp|P0A6Z0|DNAK_ECO57 Chaperone protein DnaK OS=Escherichia coli O157:H7 GN=dnaK PE=3 SV=2 18 187 8.0E-22
sp|A7ZHA4|DNAK_ECO24 Chaperone protein DnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=3 SV=1 18 187 8.0E-22
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 17 174 8.0E-22
sp|C5B7L7|DNAK_EDWI9 Chaperone protein DnaK OS=Edwardsiella ictaluri (strain 93-146) GN=dnaK PE=3 SV=1 17 179 9.0E-22
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 17 187 9.0E-22
sp|P19993|DNAK_MYCLE Chaperone protein DnaK OS=Mycobacterium leprae (strain TN) GN=dnaK PE=1 SV=5 17 178 9.0E-22
sp|B8ZTB7|DNAK_MYCLB Chaperone protein DnaK OS=Mycobacterium leprae (strain Br4923) GN=dnaK PE=3 SV=1 17 178 9.0E-22
sp|Q3YRR6|DNAK_EHRCJ Chaperone protein DnaK OS=Ehrlichia canis (strain Jake) GN=dnaK PE=3 SV=1 17 186 9.0E-22
sp|Q83MH5|DNAK_SHIFL Chaperone protein DnaK OS=Shigella flexneri GN=dnaK PE=3 SV=1 18 187 1.0E-21
sp|Q0T8H6|DNAK_SHIF8 Chaperone protein DnaK OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaK PE=3 SV=1 18 187 1.0E-21
sp|A9MR77|DNAK_SALAR Chaperone protein DnaK OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaK PE=3 SV=1 18 187 1.0E-21
sp|Q3IYM7|DNAK_RHOS4 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=3 SV=1 18 136 1.0E-21
sp|Q9LDZ0|HSP7J_ARATH Heat shock 70 kDa protein 10, mitochondrial OS=Arabidopsis thaliana GN=HSP70-10 PE=2 SV=1 18 181 1.0E-21
sp|P12076|HSP71_LEIMA Heat shock 70-related protein 1, mitochondrial OS=Leishmania major GN=HSP70.1 PE=3 SV=3 3 192 1.0E-21
sp|B8E4S1|DNAK_SHEB2 Chaperone protein DnaK OS=Shewanella baltica (strain OS223) GN=dnaK PE=3 SV=1 18 178 1.0E-21
sp|A3PNM1|DNAK_RHOS1 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=3 SV=1 18 136 1.0E-21
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 13 164 1.0E-21
sp|Q8Z9R1|DNAK_SALTI Chaperone protein DnaK OS=Salmonella typhi GN=dnaK PE=3 SV=3 18 187 1.0E-21
sp|B4TVZ5|DNAK_SALSV Chaperone protein DnaK OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaK PE=3 SV=1 18 187 1.0E-21
sp|B5BLH8|DNAK_SALPK Chaperone protein DnaK OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaK PE=3 SV=1 18 187 1.0E-21
sp|Q5PDJ5|DNAK_SALPA Chaperone protein DnaK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaK PE=3 SV=1 18 187 1.0E-21
sp|B4TIB4|DNAK_SALHS Chaperone protein DnaK OS=Salmonella heidelberg (strain SL476) GN=dnaK PE=3 SV=1 18 187 1.0E-21
sp|B5F6Y8|DNAK_SALA4 Chaperone protein DnaK OS=Salmonella agona (strain SL483) GN=dnaK PE=3 SV=1 18 187 1.0E-21
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 18 189 1.0E-21
sp|Q465Y6|DNAK_METBF Chaperone protein DnaK OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=dnaK PE=3 SV=1 3 192 1.0E-21
sp|B3DZP7|DNAK_METI4 Chaperone protein DnaK OS=Methylacidiphilum infernorum (isolate V4) GN=dnaK PE=3 SV=1 3 143 1.0E-21
sp|Q5WV15|DNAK_LEGPL Chaperone protein DnaK OS=Legionella pneumophila (strain Lens) GN=dnaK PE=3 SV=1 18 172 1.0E-21
sp|A5IDK8|DNAK_LEGPC Chaperone protein DnaK OS=Legionella pneumophila (strain Corby) GN=dnaK PE=3 SV=1 18 172 1.0E-21
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 18 164 1.0E-21
sp|Q5X3M7|DNAK_LEGPA Chaperone protein DnaK OS=Legionella pneumophila (strain Paris) GN=dnaK PE=3 SV=1 18 172 1.0E-21
sp|Q253K1|DNAK_CHLFF Chaperone protein DnaK OS=Chlamydophila felis (strain Fe/C-56) GN=dnaK PE=3 SV=1 18 145 1.0E-21
sp|O87384|DNAK_VIBHA Chaperone protein DnaK OS=Vibrio harveyi GN=dnaK PE=3 SV=1 18 186 1.0E-21
sp|Q8G6W1|DNAK_BIFLO Chaperone protein DnaK OS=Bifidobacterium longum (strain NCC 2705) GN=dnaK PE=3 SV=1 18 195 1.0E-21
sp|B3DNP9|DNAK_BIFLD Chaperone protein DnaK OS=Bifidobacterium longum (strain DJO10A) GN=dnaK PE=3 SV=1 18 195 1.0E-21
sp|A0B747|DNAK_METTP Chaperone protein DnaK OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=dnaK PE=3 SV=1 13 175 1.0E-21
sp|B7GT47|DNAK_BIFLS Chaperone protein DnaK OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=dnaK PE=3 SV=1 18 195 1.0E-21
sp|A6WFV7|DNAK_KINRD Chaperone protein DnaK OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dnaK PE=3 SV=1 18 171 1.0E-21
sp|P83784|HSP77_CANAL Heat shock protein SSC1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSC1 PE=1 SV=2 18 162 1.0E-21
sp|Q15UD3|DNAK_PSEA6 Chaperone protein DnaK OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaK PE=3 SV=1 17 186 1.0E-21
sp|Q5NPS6|DNAK_ZYMMO Chaperone protein DnaK OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaK PE=3 SV=1 18 172 1.0E-21
sp|Q3JP10|DNAK_BURP1 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1710b) GN=dnaK PE=3 SV=1 17 164 1.0E-21
sp|C0R3W7|DNAK_WOLWR Chaperone protein DnaK OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=dnaK PE=3 SV=1 18 141 1.0E-21
sp|O68191|DNAK_BURPS Chaperone protein DnaK OS=Burkholderia pseudomallei (strain K96243) GN=dnaK PE=3 SV=2 17 164 2.0E-21
sp|A3ND68|DNAK_BURP6 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 668) GN=dnaK PE=3 SV=1 17 164 2.0E-21
sp|A3NYX7|DNAK_BURP0 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1106a) GN=dnaK PE=3 SV=1 17 164 2.0E-21
sp|A1V0U6|DNAK_BURMS Chaperone protein DnaK OS=Burkholderia mallei (strain SAVP1) GN=dnaK PE=3 SV=1 17 164 2.0E-21
sp|Q62HD5|DNAK_BURMA Chaperone protein DnaK OS=Burkholderia mallei (strain ATCC 23344) GN=dnaK PE=3 SV=1 17 164 2.0E-21
sp|A2S565|DNAK_BURM9 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10229) GN=dnaK PE=3 SV=1 17 164 2.0E-21
sp|A3MN99|DNAK_BURM7 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10247) GN=dnaK PE=3 SV=1 17 164 2.0E-21
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 18 188 2.0E-21
sp|Q93GF1|DNAK_PRELO Chaperone protein DnaK OS=Prevotella loescheii GN=dnaK PE=3 SV=1 12 164 2.0E-21
sp|Q2SYZ4|DNAK_BURTA Chaperone protein DnaK OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaK PE=3 SV=1 17 164 2.0E-21
sp|Q47TI0|DNAK_THEFY Chaperone protein DnaK OS=Thermobifida fusca (strain YX) GN=dnaK PE=3 SV=1 18 145 2.0E-21
sp|A1K4C5|DNAK_AZOSB Chaperone protein DnaK OS=Azoarcus sp. (strain BH72) GN=dnaK PE=3 SV=1 17 188 2.0E-21
sp|O32482|DNAK_LEGPN Chaperone protein DnaK OS=Legionella pneumophila GN=dnaK PE=3 SV=1 18 172 2.0E-21
sp|Q5ZTY3|DNAK_LEGPH Chaperone protein DnaK OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaK PE=3 SV=2 18 172 2.0E-21
sp|Q9ZDX9|DNAK_RICPR Chaperone protein DnaK OS=Rickettsia prowazekii (strain Madrid E) GN=dnaK PE=3 SV=1 18 177 2.0E-21
sp|B2SGV8|DNAK_FRATM Chaperone protein DnaK OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|Q55154|DNAK1_SYNY3 Chaperone protein dnaK1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK1 PE=3 SV=1 18 134 2.0E-21
sp|A8GR22|DNAK_RICRS Chaperone protein DnaK OS=Rickettsia rickettsii (strain Sheila Smith) GN=dnaK PE=3 SV=1 18 172 2.0E-21
sp|B0BWH1|DNAK_RICRO Chaperone protein DnaK OS=Rickettsia rickettsii (strain Iowa) GN=dnaK PE=3 SV=1 18 172 2.0E-21
sp|A0Q7F0|DNAK_FRATN Chaperone protein DnaK OS=Francisella tularensis subsp. novicida (strain U112) GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|A6Q421|DNAK_NITSB Chaperone protein DnaK OS=Nitratiruptor sp. (strain SB155-2) GN=dnaK PE=3 SV=1 18 134 2.0E-21
sp|P48205|DNAK_FRATU Chaperone protein DnaK OS=Francisella tularensis GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 18 164 2.0E-21
sp|Q1AXX6|DNAK_RUBXD Chaperone protein DnaK OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=dnaK PE=3 SV=1 18 185 2.0E-21
sp|A4IX28|DNAK_FRATW Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|Q5NFG7|DNAK_FRATT Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|Q14GW9|DNAK_FRAT1 Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|A7H484|DNAK_CAMJD Chaperone protein DnaK OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaK PE=3 SV=1 18 188 2.0E-21
sp|Q0BLK4|DNAK_FRATO Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|Q2A328|DNAK_FRATH Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|A7NCM9|DNAK_FRATF Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dnaK PE=3 SV=1 18 178 2.0E-21
sp|B1ZGR1|DNAK_METPB Chaperone protein DnaK OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaK PE=3 SV=1 18 176 2.0E-21
sp|Q03683|BIP3_TOBAC Luminal-binding protein 3 (Fragment) OS=Nicotiana tabacum GN=BIP3 PE=2 SV=1 56 177 2.0E-21
sp|Q06W39|DNAK_PYRHA Chaperone protein dnaK OS=Pyropia haitanensis GN=dnaK PE=3 SV=1 3 175 2.0E-21
sp|Q2SMM8|DNAK_HAHCH Chaperone protein DnaK OS=Hahella chejuensis (strain KCTC 2396) GN=dnaK PE=3 SV=1 18 187 2.0E-21
sp|A9W6R7|DNAK_METEP Chaperone protein DnaK OS=Methylobacterium extorquens (strain PA1) GN=dnaK PE=3 SV=1 18 172 2.0E-21
sp|P47547|DNAK_MYCGE Chaperone protein DnaK OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaK PE=3 SV=1 18 146 2.0E-21
sp|A7ZVV7|DNAK_ECOHS Chaperone protein DnaK OS=Escherichia coli O9:H4 (strain HS) GN=dnaK PE=3 SV=1 18 187 3.0E-21
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 13 162 3.0E-21
sp|B1I699|DNAK_DESAP Chaperone protein DnaK OS=Desulforudis audaxviator (strain MP104C) GN=dnaK PE=3 SV=1 18 136 3.0E-21
sp|Q31HA7|DNAK_THICR Chaperone protein DnaK OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaK PE=3 SV=1 13 197 3.0E-21
sp|Q5N1J4|DNAK2_SYNP6 Chaperone protein DnaK 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK2 PE=3 SV=1 3 170 3.0E-21
sp|B0BC31|DNAK_CHLTB Chaperone protein DnaK OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaK PE=3 SV=1 18 145 3.0E-21
sp|Q3KLV7|DNAK_CHLTA Chaperone protein DnaK OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaK PE=3 SV=1 18 145 3.0E-21
sp|B0B7W6|DNAK_CHLT2 Chaperone protein DnaK OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaK PE=3 SV=1 18 145 3.0E-21
sp|B5YAR3|DNAK_DICT6 Chaperone protein DnaK OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaK PE=3 SV=1 18 136 3.0E-21
sp|P17821|DNAK_CHLTR Chaperone protein DnaK OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaK PE=3 SV=4 18 145 3.0E-21
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 13 166 3.0E-21
sp|B4F2V5|DNAK_PROMH Chaperone protein DnaK OS=Proteus mirabilis (strain HI4320) GN=dnaK PE=3 SV=1 17 166 3.0E-21
sp|B3Q972|DNAK_RHOPT Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=3 SV=1 18 187 3.0E-21
sp|Q6NCY4|DNAK_RHOPA Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaK PE=3 SV=1 18 187 3.0E-21
sp|Q57TP3|DNAK_SALCH Chaperone protein DnaK OS=Salmonella choleraesuis (strain SC-B67) GN=dnaK PE=3 SV=1 18 187 3.0E-21
sp|Q6LUA7|DNAK1_PHOPR Chaperone protein DnaK 1 OS=Photobacterium profundum GN=dnaK1 PE=3 SV=1 18 186 3.0E-21
sp|A4XKA4|DNAK_CALS8 Chaperone protein DnaK OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaK PE=3 SV=1 13 164 3.0E-21
sp|Q4FPS9|DNAK_PSYA2 Chaperone protein DnaK OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaK PE=3 SV=1 17 188 3.0E-21
sp|Q56073|DNAK_SALTY Chaperone protein DnaK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaK PE=3 SV=2 18 187 3.0E-21
sp|C0Q4F3|DNAK_SALPC Chaperone protein DnaK OS=Salmonella paratyphi C (strain RKS4594) GN=dnaK PE=3 SV=1 18 187 3.0E-21
sp|A9MXI2|DNAK_SALPB Chaperone protein DnaK OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaK PE=3 SV=1 18 187 3.0E-21
sp|B4T6D6|DNAK_SALNS Chaperone protein DnaK OS=Salmonella newport (strain SL254) GN=dnaK PE=3 SV=1 18 187 3.0E-21
sp|B5RF08|DNAK_SALG2 Chaperone protein DnaK OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaK PE=3 SV=1 18 187 3.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4520
MSFPHNWHLERHRNPLTFTTVSDNQQSVQFPVYQGERVNCEDNTSLGEFTLSPIPPMRAGEAVLECVFDVDVNGI
LKVTATEKTSGRSANITISNSVGKLSTDEIEKMISEAEKFKTNDEAFSKKFEAKQQLESYIGRVEEIVSDPTLSL
KLKRGQKEKIESTISDAMAALELNESSADDLRKQELALKRLVTKAMSSR*
Coding >Hirsu2|4520
ATGTCGTTCCCGCACAACTGGCACCTGGAGAGACACCGGAACCCCTTAACCTTCACGACCGTTTCCGATAACCAG
CAGTCTGTGCAGTTCCCTGTTTACCAGGGCGAGCGAGTCAATTGCGAGGACAACACCTCTCTGGGCGAGTTTACA
CTTTCTCCAATTCCGCCTATGCGTGCTGGCGAAGCGGTTCTCGAGTGCGTCTTCGACGTGGACGTCAACGGCATT
TTGAAAGTCACGGCGACGGAGAAGACATCTGGGCGCAGCGCGAACATCACAATCAGCAACTCGGTCGGCAAGCTG
TCTACGGATGAGATCGAGAAGATGATCAGCGAGGCGGAGAAGTTCAAGACCAACGACGAGGCCTTCAGCAAGAAG
TTTGAGGCCAAGCAGCAGCTCGAGTCGTACATCGGCCGTGTCGAGGAGATTGTGTCGGACCCGACGCTGTCGCTC
AAGCTCAAGAGGGGCCAGAAGGAGAAGATCGAGAGCACCATCAGCGACGCCATGGCCGCCTTGGAGCTCAACGAG
AGCTCGGCCGACGACTTGAGGAAGCAGGAGCTGGCCCTGAAGCGCCTGGTGACGAAGGCCATGTCGTCGCGATAA
Transcript >Hirsu2|4520
ATGTCGTTCCCGCACAACTGGCACCTGGAGAGACACCGGAACCCCTTAACCTTCACGACCGTTTCCGATAACCAG
CAGTCTGTGCAGTTCCCTGTTTACCAGGGCGAGCGAGTCAATTGCGAGGACAACACCTCTCTGGGCGAGTTTACA
CTTTCTCCAATTCCGCCTATGCGTGCTGGCGAAGCGGTTCTCGAGTGCGTCTTCGACGTGGACGTCAACGGCATT
TTGAAAGTCACGGCGACGGAGAAGACATCTGGGCGCAGCGCGAACATCACAATCAGCAACTCGGTCGGCAAGCTG
TCTACGGATGAGATCGAGAAGATGATCAGCGAGGCGGAGAAGTTCAAGACCAACGACGAGGCCTTCAGCAAGAAG
TTTGAGGCCAAGCAGCAGCTCGAGTCGTACATCGGCCGTGTCGAGGAGATTGTGTCGGACCCGACGCTGTCGCTC
AAGCTCAAGAGGGGCCAGAAGGAGAAGATCGAGAGCACCATCAGCGACGCCATGGCCGCCTTGGAGCTCAACGAG
AGCTCGGCCGACGACTTGAGGAAGCAGGAGCTGGCCCTGAAGCGCCTGGTGACGAAGGCCATGTCGTCGCGATAA
Gene >Hirsu2|4520
ATGTCGTTCCCGCACAACTGGCACCTGGAGAGACACCGGAACCCCTTGTACCTTTGTATCTTTCACGCCTGTCCT
TGCTGACTCATATACGTCACCCACCCTTCTTCACTCCACCCCCCTTTGCCTTTCACGATGCCCTCTTATCCGCCT
CCTGATGGCCTGCCCTCGTTACAACCATCCAGGATTCGTTGCCCTCGATCATCGTCAACTGACAGTTTCTCAATA
GAACCTTCACGACCGTTTCCGATAACCAGCAGTGTAGCTCCCCCCGTTCCCCACGGCTAAACGATACCTTACTAA
CTTCTATCAACAGCTGTGCAGTTCCCTGTTTACCAGGGCGAGCGAGTCAATTGCGAGGACAACACCTCTCTGGGC
GAGTTTACACTTTCTCCAATTCCGCCTATGCGTGCTGGCGAAGCGGTTCTCGAGTGCGTCTTCGACGTGGACGTC
AACGGCATTTTGAAAGTCACGGCGACGGAGAAGACATCTGGGCGCAGCGCGAACATCACAATCAGCAACTCGGTC
GGCAAGCTGTCTACGGATGAGATCGAGAAGATGATCAGCGAGGCGGAGAAGTTCAAGACCAACGACGAGGCCTTC
AGCAAGAAGTTTGAGGCCAAGCAGCAGCTCGAGTCGTACATCGGCCGTGTCGAGGAGATTGTGTCGGACCCGACG
CTGTCGCTCAAGCTCAAGAGGGGCCAGAAGGAGAAGATCGAGAGCACCATCAGCGACGCCATGGCCGCCTTGGAG
CTCAACGAGAGCTCGGCCGACGACTTGAGGAAGCAGGAGCTGGCCCTGAAGCGCCTGGTGACGAAGGCCATGTCG
TCGCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail