Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4512
Gene name
LocationContig_2298:1017..2417
Strand+
Gene length (bp)1400
Transcript length (bp)1278
Coding sequence length (bp)1278
Protein length (aa) 426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07798 DUF1640 Protein of unknown function (DUF1640) 2.9E-47 207 380

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42997|YBC7_SCHPO Uncharacterized protein C27B12.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi071 PE=4 SV=1 163 376 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 364 386 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4512
MSTGRLTFLYPHLVRSAARPLGTTAKRTKGSFAPRHGKAVEPAAWEERQKQKEQQQQQQQRRRPQLSPSSSLSSS
SSSSSSPQPPPPPQSKQSNAIRTRTAEPDRVSAGEPLPARQDEAPGLPPAPKQAPRPKPTLLPALPEKLGRAPSA
ATENGRFNRDGSSERLRPTGSQPRDSSPLEAVLLTQPPERESAQHPSMSPPPYVHHFDSYSLVKQLQEGGYSQEQ
ATTAMKAIRTLLAQNLDVAQQSLVSKSDVENETYLFTAACSELSAEIKNNRRLRDEQMRQQRTHLQHEVDILTQS
LNQELLTLTDNVRGMFNDRKMTVREEHKAVESAIQKINYKMSILLSSDCKSEIEGVRWILIRRSVLGIIFMAILT
LGMLRYATYLGQKRKLEAEKKKKEREELRRDGGKTDHSAAADAAAILAAN*
Coding >Hirsu2|4512
ATGTCGACGGGCCGACTCACCTTCCTCTACCCGCACCTGGTGCGCAGCGCCGCGAGGCCGCTGGGGACGACGGCC
AAGCGGACCAAGGGATCCTTCGCCCCGCGCCACGGCAAGGCCGTTGAGCCCGCCGCCTGGGAAGAGCGCCAGAAG
CAAAAGGAGCAGCAGCAGCAGCAGCAGCAGAGACGGCGGCCGCAGCTCTCCCCTTCTTCGTCCTTGTCCTCGTCC
TCGTCCTCGTCCTCGTCGCCGCAGCCGCCGCCGCCGCCGCAGTCGAAGCAGTCAAACGCGATCAGGACCAGAACA
GCCGAGCCGGACCGCGTGAGCGCGGGCGAACCTTTACCGGCGAGACAAGACGAGGCACCAGGGTTGCCACCGGCT
CCCAAGCAGGCGCCTCGGCCCAAGCCGACGCTGCTGCCCGCCCTCCCCGAAAAGCTTGGTCGGGCCCCCAGCGCA
GCGACCGAGAATGGCCGATTCAACAGAGACGGCTCGTCCGAACGGCTGCGGCCGACGGGGAGCCAGCCCAGGGAC
AGCAGCCCGCTCGAGGCGGTGCTTCTCACACAGCCGCCCGAGCGCGAGTCGGCTCAGCATCCGTCCATGTCCCCC
CCGCCCTATGTGCACCACTTCGACAGCTACTCCCTCGTCAAGCAGCTGCAGGAGGGCGGCTACTCGCAGGAGCAG
GCGACGACGGCCATGAAGGCCATCCGGACCCTGCTGGCCCAGAACCTGGACGTGGCACAGCAGAGCCTGGTGAGC
AAGAGCGACGTGGAAAACGAAACCTATCTCTTCACCGCTGCCTGCTCCGAGCTGAGCGCCGAGATCAAGAACAAT
CGGAGGCTGCGGGACGAGCAGATGCGGCAGCAGAGGACGCATCTGCAGCACGAGGTGGACATTTTGACGCAGTCG
CTCAACCAAGAGCTGCTGACGCTGACCGACAACGTCCGCGGCATGTTCAACGACCGCAAGATGACGGTCCGGGAG
GAGCACAAGGCCGTGGAGAGCGCGATCCAGAAGATCAACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAG
TCGGAGATTGAGGGCGTCCGCTGGATCCTGATCAGGCGGTCCGTGCTGGGCATCATCTTCATGGCCATCCTGACG
CTCGGCATGCTGCGCTACGCCACCTACCTCGGACAGAAGAGGAAGCTGGAGGCGGAAAAGAAGAAGAAGGAGCGG
GAGGAGCTGAGGAGGGACGGCGGCAAGACGGACCACAGCGCGGCGGCGGACGCGGCCGCCATCCTGGCCGCCAAT
TAG
Transcript >Hirsu2|4512
ATGTCGACGGGCCGACTCACCTTCCTCTACCCGCACCTGGTGCGCAGCGCCGCGAGGCCGCTGGGGACGACGGCC
AAGCGGACCAAGGGATCCTTCGCCCCGCGCCACGGCAAGGCCGTTGAGCCCGCCGCCTGGGAAGAGCGCCAGAAG
CAAAAGGAGCAGCAGCAGCAGCAGCAGCAGAGACGGCGGCCGCAGCTCTCCCCTTCTTCGTCCTTGTCCTCGTCC
TCGTCCTCGTCCTCGTCGCCGCAGCCGCCGCCGCCGCCGCAGTCGAAGCAGTCAAACGCGATCAGGACCAGAACA
GCCGAGCCGGACCGCGTGAGCGCGGGCGAACCTTTACCGGCGAGACAAGACGAGGCACCAGGGTTGCCACCGGCT
CCCAAGCAGGCGCCTCGGCCCAAGCCGACGCTGCTGCCCGCCCTCCCCGAAAAGCTTGGTCGGGCCCCCAGCGCA
GCGACCGAGAATGGCCGATTCAACAGAGACGGCTCGTCCGAACGGCTGCGGCCGACGGGGAGCCAGCCCAGGGAC
AGCAGCCCGCTCGAGGCGGTGCTTCTCACACAGCCGCCCGAGCGCGAGTCGGCTCAGCATCCGTCCATGTCCCCC
CCGCCCTATGTGCACCACTTCGACAGCTACTCCCTCGTCAAGCAGCTGCAGGAGGGCGGCTACTCGCAGGAGCAG
GCGACGACGGCCATGAAGGCCATCCGGACCCTGCTGGCCCAGAACCTGGACGTGGCACAGCAGAGCCTGGTGAGC
AAGAGCGACGTGGAAAACGAAACCTATCTCTTCACCGCTGCCTGCTCCGAGCTGAGCGCCGAGATCAAGAACAAT
CGGAGGCTGCGGGACGAGCAGATGCGGCAGCAGAGGACGCATCTGCAGCACGAGGTGGACATTTTGACGCAGTCG
CTCAACCAAGAGCTGCTGACGCTGACCGACAACGTCCGCGGCATGTTCAACGACCGCAAGATGACGGTCCGGGAG
GAGCACAAGGCCGTGGAGAGCGCGATCCAGAAGATCAACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAG
TCGGAGATTGAGGGCGTCCGCTGGATCCTGATCAGGCGGTCCGTGCTGGGCATCATCTTCATGGCCATCCTGACG
CTCGGCATGCTGCGCTACGCCACCTACCTCGGACAGAAGAGGAAGCTGGAGGCGGAAAAGAAGAAGAAGGAGCGG
GAGGAGCTGAGGAGGGACGGCGGCAAGACGGACCACAGCGCGGCGGCGGACGCGGCCGCCATCCTGGCCGCCAAT
TAG
Gene >Hirsu2|4512
ATGTCGACGGGCCGACTCACCTTCCTCTACCCGCACCTGGTGCGCAGCGCCGCGAGGCCGCTGGGGACGACGGCC
AAGCGGACCAAGGGATCCTTCGCCCCGCGCCACGGCAAGGCCGTTGAGCCCGCCGCCTGGGAAGAGCGCCAGAAG
CAAAAGGAGCAGCAGCAGCAGCAGCAGCAGAGACGGCGGCCGCAGCTCTCCCCTTCTTCGTCCTTGTCCTCGTCC
TCGTCCTCGTCCTCGTCGCCGCAGCCGCCGCCGCCGCCGCAGTCGAAGCAGTCAAACGCGATCAGGACCAGAACA
GCCGAGCCGGACCGCGTGAGCGCGGGCGAACCTTTACCGGCGAGACAAGACGAGGCACCAGGGTTGCCACCGGCT
CCCAAGCAGGCGCCTCGGCCCAAGCCGACGCTGCTGCCCGCCCTCCCCGAAAAGCTTGGTCGGGCCCCCAGCGCA
GCGACCGAGAATGGCCGATTCAACAGAGACGGCTCGTCCGAACGGCTGCGGCCGACGGGGAGCCAGCCCAGGGAC
AGCAGCCCGCTCGAGGCGGTGCTTCTCACACAGCCGCCCGAGCGCGAGTCGGCTCAGCATCCGTCCATGTCCCCC
CCGCCCTATGTGCACCACTTCGACAGCTACTCCCTCGTCAAGCAGCTGCAGGAGGGCGGCTACTCGCAGGAGCAG
GCGACGACGGCCATGAAGGCCATCCGGACCCTGCTGGCCCAGAACCTGGACGTGGCACAGCAGAGCCTGGTGAGC
AAGAGCGACGTGGAAAACGTACGGCATGCTCCCCCGCCCATCAGCCCGCTTCGGATGCTGACGCACGGCAGGAAA
CCTATCTCTTCACCGCTGCCTGCTCCGAGCTGAGCGCCGAGATCAAGAACAATCGGAGGCTGCGGGACGAGCAGA
TGCGGCAGCAGAGGACGCATCTGCAGCACGAGGTGGACATTTTGACGCAGTCGCTCAACCAAGAGCTGCTGACGC
TGACCGACAACGTCCGCGGCATGTTCAACGACCGCAAGATGACGGTCCGGGAGGAGCACAAGGCCGTGGAGAGCG
CGGTACGTCTTCCTTTCGCCCGCGCCCATCCTTCCGCCTCCTGAGAGCCTGTTTGCCTGACGCCACGACAGATCC
AGAAGATCAACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAGTCGGAGATTGAGGGCGTCCGCTGGATCC
TGATCAGGCGGTCCGTGCTGGGCATCATCTTCATGGCCATCCTGACGCTCGGCATGCTGCGCTACGCCACCTACC
TCGGACAGAAGAGGAAGCTGGAGGCGGAAAAGAAGAAGAAGGAGCGGGAGGAGCTGAGGAGGGACGGCGGCAAGA
CGGACCACAGCGCGGCGGCGGACGCGGCCGCCATCCTGGCCGCCAATTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail