Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4510
Gene name
LocationContig_2296:181..2191
Strand-
Gene length (bp)2010
Transcript length (bp)1938
Coding sequence length (bp)1938
Protein length (aa) 646

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 2.7E-203 63 601

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 23 645 0.0E+00
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 21 645 2.0E-175
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 24 645 4.0E-174
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 1 645 1.0E-172
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 18 645 6.0E-168
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 23 645 0.0E+00
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 21 645 2.0E-175
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 24 645 4.0E-174
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 1 645 1.0E-172
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 18 645 6.0E-168
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 18 645 8.0E-167
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 18 645 2.0E-166
sp|P58021|TM9S2_MOUSE Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=1 SV=1 18 645 3.0E-166
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 24 645 1.0E-164
sp|Q9Y819|YON8_SCHPO Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.08 PE=3 SV=1 24 645 1.0E-159
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 15 645 4.0E-158
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 22 645 5.0E-158
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 22 645 1.0E-155
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 22 645 2.0E-155
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 24 645 2.0E-155
sp|Q55FP0|PHG1A_DICDI Putative phagocytic receptor 1a OS=Dictyostelium discoideum GN=phg1a PE=2 SV=1 25 645 4.0E-154
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 15 645 7.0E-154
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 15 645 1.0E-153
sp|Q9FYQ8|TMN11_ARATH Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana GN=TMN11 PE=2 SV=1 14 645 2.0E-125
sp|F4JRE0|TMN12_ARATH Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana GN=TMN12 PE=2 SV=1 15 645 7.0E-114
sp|Q9ZPS7|TMN3_ARATH Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana GN=TMN3 PE=2 SV=1 8 645 3.0E-102
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 26 645 8.0E-102
sp|Q940S0|TMN2_ARATH Transmembrane 9 superfamily member 2 OS=Arabidopsis thaliana GN=TMN2 PE=2 SV=1 7 645 6.0E-97
sp|Q940G0|TMN1_ARATH Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana GN=TMN1 PE=1 SV=1 34 645 3.0E-90
sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens GN=TM9SF3 PE=1 SV=2 238 645 3.0E-85
sp|Q9ET30|TM9S3_MOUSE Transmembrane 9 superfamily member 3 OS=Mus musculus GN=Tm9sf3 PE=1 SV=1 238 645 3.0E-85
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 33 645 6.0E-85
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 28 645 1.0E-82
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 28 645 2.0E-82
sp|Q54ZW0|PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum GN=phg1b PE=2 SV=1 35 645 3.0E-82
sp|Q5R8F1|TM9S1_PONAB Transmembrane 9 superfamily member 1 OS=Pongo abelii GN=TM9SF1 PE=2 SV=1 28 645 6.0E-82
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 31 645 2.0E-79
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 14 645 7.0E-77
sp|P40071|TMN3_YEAST Transmembrane 9 superfamily member 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN3 PE=1 SV=1 30 639 5.0E-54
sp|Q7YTA6|PHG1C_DICDI Putative phagocytic receptor 1c OS=Dictyostelium discoideum GN=phg1c PE=2 SV=1 226 645 5.0E-45
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 271 293 22
2 349 371 22
3 381 403 22
4 416 438 22
5 453 475 22
6 508 530 22
7 540 562 22
8 575 597 22
9 612 634 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4510
MHLRDAAPTALLAALLAAPRLASAFYLPGVAPTSYKPGDRVPLDVNRIRPVAAPDYRLHSVVSYDYYHPAFQFCE
PAGGPQSVPESLGSILSGDRLMTSPFELLMAKNETCKPLCKARYSENMKVFINERIEESYSLDWLVDGLPAGQQI
RDDLTGTTFYSPGFQLGGFYITEAEEEEVSFNNHYEIWIEYHEVNGRPNELRVVGAVVQPTSKDYPGPADCADNH
PPLALTATQEEQEVQFSYSVYWRKSDTAWATRWDKYLHVFDPKIHWFWLIDTAVIVVILVLTVMSVLVRTLKKDI
ARYNRLDQISLDDLGGTSVVEEGVQEDSGWKLVHGDVFRNPSHPLLLSILLGNGAQLFVMTGCTIVFALLGFLSP
SNRGSLGTIMIILYTLLGFVGGYASARTYKAMQGEQWKLNIALTPLLVPGIVFAVFFLLDLFLWAKQSSGAVPFT
TMLVIIAIWFVISIPLSVVGSWLGFRSPRVEPPVRTNQIPRQIPPVTTYLKPIPSMLIVGLLPFGAIFVELYFIL
SSIWFSRIYYMFGFLFLCYGLMIVVCAAVTILMTYFLLCAENYNWQWRSFLAAGMSGGYIFFNCLLYLLTKVKLS
SLAGVVLYVGYSALISFMFFILAGSIGYFASWWFVRKIYASIKID*
Coding >Hirsu2|4510
ATGCACCTCCGAGATGCCGCGCCGACGGCGCTGCTCGCCGCCCTCTTGGCCGCCCCCCGGCTCGCGTCCGCCTTC
TACCTGCCAGGTGTCGCGCCGACGTCGTACAAGCCCGGCGACCGGGTCCCGCTCGACGTCAACCGCATACGGCCC
GTGGCCGCGCCCGACTACCGTCTGCACTCGGTCGTCTCGTACGACTACTACCACCCGGCCTTCCAGTTCTGCGAG
CCGGCCGGCGGCCCGCAGTCGGTGCCCGAGAGCCTGGGCAGCATCCTGTCGGGCGACCGGCTGATGACGTCGCCC
TTCGAGCTGCTCATGGCCAAGAACGAGACGTGCAAGCCGCTGTGCAAGGCGCGCTACTCGGAGAACATGAAGGTC
TTCATCAACGAGAGGATCGAGGAGTCGTACAGCCTCGACTGGCTCGTCGACGGCCTGCCCGCCGGCCAGCAGATC
CGCGACGACCTGACCGGCACCACCTTCTACAGCCCCGGCTTCCAGCTCGGCGGCTTCTACATCACCGAGGCCGAG
GAGGAGGAGGTCTCGTTCAACAACCACTACGAGATCTGGATCGAGTACCACGAGGTCAACGGCCGGCCCAACGAG
CTGCGCGTCGTCGGCGCCGTCGTCCAGCCCACCTCCAAGGACTACCCCGGCCCGGCCGACTGCGCCGACAACCAC
CCGCCCCTGGCCCTGACCGCCACCCAGGAGGAGCAGGAGGTGCAGTTCAGCTACAGCGTCTACTGGAGGAAGTCG
GACACGGCCTGGGCCACCCGCTGGGACAAGTACCTCCACGTCTTCGACCCCAAGATCCACTGGTTCTGGCTCATC
GACACGGCCGTCATCGTCGTCATCCTCGTCCTGACCGTCATGTCCGTCCTCGTCCGCACCCTCAAGAAGGACATT
GCGCGCTACAACCGGCTGGACCAGATCAGCCTCGACGACCTGGGCGGCACCTCGGTCGTCGAGGAGGGCGTGCAG
GAGGACTCGGGCTGGAAGCTGGTCCACGGCGACGTCTTCCGCAACCCCTCGCACCCGCTGCTGCTGTCCATCCTC
CTCGGCAACGGCGCCCAGCTGTTCGTCATGACCGGCTGCACCATCGTCTTCGCCCTGCTCGGCTTCCTGTCGCCC
TCGAACCGCGGCTCGCTCGGCACCATCATGATCATCCTCTACACCCTCCTCGGCTTCGTCGGCGGCTACGCCTCG
GCCCGGACCTACAAGGCCATGCAGGGCGAGCAGTGGAAGCTCAACATCGCCCTGACGCCCCTGCTCGTCCCCGGC
ATCGTCTTCGCCGTCTTCTTCCTCCTCGACCTCTTCCTGTGGGCCAAGCAGTCGTCGGGCGCGGTGCCCTTCACC
ACCATGCTCGTCATCATCGCCATCTGGTTCGTCATCTCCATCCCGCTCTCCGTCGTCGGCTCCTGGCTCGGCTTC
CGCAGCCCGCGCGTCGAGCCGCCGGTCCGGACGAACCAGATCCCGCGCCAGATCCCGCCCGTCACCACCTACCTC
AAGCCCATCCCCAGCATGCTCATCGTCGGCCTGCTGCCCTTTGGCGCCATCTTCGTCGAGCTGTACTTCATCCTG
AGCTCCATCTGGTTCAGCCGCATCTACTACATGTTCGGCTTCCTCTTCCTCTGCTACGGCCTGATGATTGTCGTC
TGCGCCGCCGTCACCATCCTCATGACCTACTTCTTGCTGTGCGCCGAGAACTACAACTGGCAGTGGCGCTCCTTC
CTCGCCGCCGGCATGAGCGGCGGCTACATCTTCTTCAACTGCCTGCTCTACCTCCTGACCAAGGTCAAGCTCAGC
AGCCTCGCCGGCGTCGTGCTCTACGTCGGCTACAGCGCCCTCATCTCCTTCATGTTCTTCATCCTCGCCGGCTCT
ATTGGCTACTTTGCTAGCTGGTGGTTCGTGAGGAAGATTTACGCCTCTATCAAGATTGACTAA
Transcript >Hirsu2|4510
ATGCACCTCCGAGATGCCGCGCCGACGGCGCTGCTCGCCGCCCTCTTGGCCGCCCCCCGGCTCGCGTCCGCCTTC
TACCTGCCAGGTGTCGCGCCGACGTCGTACAAGCCCGGCGACCGGGTCCCGCTCGACGTCAACCGCATACGGCCC
GTGGCCGCGCCCGACTACCGTCTGCACTCGGTCGTCTCGTACGACTACTACCACCCGGCCTTCCAGTTCTGCGAG
CCGGCCGGCGGCCCGCAGTCGGTGCCCGAGAGCCTGGGCAGCATCCTGTCGGGCGACCGGCTGATGACGTCGCCC
TTCGAGCTGCTCATGGCCAAGAACGAGACGTGCAAGCCGCTGTGCAAGGCGCGCTACTCGGAGAACATGAAGGTC
TTCATCAACGAGAGGATCGAGGAGTCGTACAGCCTCGACTGGCTCGTCGACGGCCTGCCCGCCGGCCAGCAGATC
CGCGACGACCTGACCGGCACCACCTTCTACAGCCCCGGCTTCCAGCTCGGCGGCTTCTACATCACCGAGGCCGAG
GAGGAGGAGGTCTCGTTCAACAACCACTACGAGATCTGGATCGAGTACCACGAGGTCAACGGCCGGCCCAACGAG
CTGCGCGTCGTCGGCGCCGTCGTCCAGCCCACCTCCAAGGACTACCCCGGCCCGGCCGACTGCGCCGACAACCAC
CCGCCCCTGGCCCTGACCGCCACCCAGGAGGAGCAGGAGGTGCAGTTCAGCTACAGCGTCTACTGGAGGAAGTCG
GACACGGCCTGGGCCACCCGCTGGGACAAGTACCTCCACGTCTTCGACCCCAAGATCCACTGGTTCTGGCTCATC
GACACGGCCGTCATCGTCGTCATCCTCGTCCTGACCGTCATGTCCGTCCTCGTCCGCACCCTCAAGAAGGACATT
GCGCGCTACAACCGGCTGGACCAGATCAGCCTCGACGACCTGGGCGGCACCTCGGTCGTCGAGGAGGGCGTGCAG
GAGGACTCGGGCTGGAAGCTGGTCCACGGCGACGTCTTCCGCAACCCCTCGCACCCGCTGCTGCTGTCCATCCTC
CTCGGCAACGGCGCCCAGCTGTTCGTCATGACCGGCTGCACCATCGTCTTCGCCCTGCTCGGCTTCCTGTCGCCC
TCGAACCGCGGCTCGCTCGGCACCATCATGATCATCCTCTACACCCTCCTCGGCTTCGTCGGCGGCTACGCCTCG
GCCCGGACCTACAAGGCCATGCAGGGCGAGCAGTGGAAGCTCAACATCGCCCTGACGCCCCTGCTCGTCCCCGGC
ATCGTCTTCGCCGTCTTCTTCCTCCTCGACCTCTTCCTGTGGGCCAAGCAGTCGTCGGGCGCGGTGCCCTTCACC
ACCATGCTCGTCATCATCGCCATCTGGTTCGTCATCTCCATCCCGCTCTCCGTCGTCGGCTCCTGGCTCGGCTTC
CGCAGCCCGCGCGTCGAGCCGCCGGTCCGGACGAACCAGATCCCGCGCCAGATCCCGCCCGTCACCACCTACCTC
AAGCCCATCCCCAGCATGCTCATCGTCGGCCTGCTGCCCTTTGGCGCCATCTTCGTCGAGCTGTACTTCATCCTG
AGCTCCATCTGGTTCAGCCGCATCTACTACATGTTCGGCTTCCTCTTCCTCTGCTACGGCCTGATGATTGTCGTC
TGCGCCGCCGTCACCATCCTCATGACCTACTTCTTGCTGTGCGCCGAGAACTACAACTGGCAGTGGCGCTCCTTC
CTCGCCGCCGGCATGAGCGGCGGCTACATCTTCTTCAACTGCCTGCTCTACCTCCTGACCAAGGTCAAGCTCAGC
AGCCTCGCCGGCGTCGTGCTCTACGTCGGCTACAGCGCCCTCATCTCCTTCATGTTCTTCATCCTCGCCGGCTCT
ATTGGCTACTTTGCTAGCTGGTGGTTCGTGAGGAAGATTTACGCCTCTATCAAGATTGACTAA
Gene >Hirsu2|4510
ATGCACCTCCGAGATGCCGCGCCGACGGCGCTGCTCGCCGCCCTCTTGGCCGCCCCCCGGCTCGCGTCCGCCTTC
TACCTGCCAGGTGTCGCGCCGACGTCGTACAAGCCCGGCGACCGGGTCCCGCTCGACGTCAACCGCATACGGCCC
GTGGCCGCGCCCGACTACCGTCTGCACTCGGTCGTCTCGTACGACTACTACCACCCGGCCTTCCAGTTCTGCGAG
CCGGCCGGCGGCCCGCAGTCGGTGCCCGAGAGCCTGGGCAGCATCCTGTCGGGCGACCGGCTGATGACGTCGCCC
TTCGAGCTGCTCATGGCCAAGAACGAGACGTGCAAGCCGCTGTGCAAGGCGCGCTACTCGGAGAACATGAAGGTC
TTCATCAACGAGAGGATCGAGGAGTCGTACAGCCTCGACTGGCTCGTCGACGGCCTGCCCGCCGGCCAGCAGATC
CGCGACGACCTGACCGGCACCACCTTCTACAGCCCCGGCTTCCAGCTCGGCGGCTTCTACATCACCGAGGCCGAG
GAGGAGGAGGTCTCGTTCAACAACCACTACGAGATCTGGATCGAGTACCACGAGGTCAACGGCCGGCCCAACGAG
CTGCGCGTCGTCGGCGCCGTCGTCCAGCCCACCTCCAAGGACTACCCCGGCCCGGCCGACTGCGCCGACAACCAC
CCGCCCCTGGCCCTGACCGCCACCCAGGAGGAGCAGGAGGTGCAGTTCAGCTACAGCGTCTACTGGAGGAAGTCG
GACACGGCCTGGGCCACCCGCTGGGACAAGTACCTCCACGTCTTCGACCCCAAGATCCACTGGTTCTGGCTCATC
GACACGGCCGTCATCGTCGTCATCCTCGTCCTGACCGTCATGTCCGTCCTCGTCCGCACCCTCAAGAAGGACATT
GCGCGCTACAACCGGCTGGACCAGATCAGCCTCGACGACCTGGGCGGCACCTCGGTCGTCGAGGAGGGCGTGCAG
GAGGACTCGGGCTGGAAGCTGGTCCACGGCGACGTCTTCCGCAACCCCTCGCACCCGCTGCTGCTGTCCATCCTC
CTCGGCAACGGCGCCCAGCTGTTCGTCATGACCGGCTGCACCATCGTCTTCGCCCTGCTCGGCTTCCTGTCGCCC
TCGAACCGCGGCTCGCTCGGCACCATCATGATCATCCTCTACACCCTCCTCGGCTTCGTCGGCGGCTACGCCTCG
GCCCGGACCTACAAGGCCATGCAGGGCGAGCAGTGGAAGCTCAACATCGCCCTGACGCCCCTGCTCGTCCCCGGC
ATCGTCTTCGCCGTCTTCTTCCTCCTCGACCTCTTCCTGTGGGCCAAGCAGTCGTCGGGCGCGGTGCCCTTCACC
ACCATGCTCGTCATCATCGCCATCTGGTTCGTCATCTCCATCCCGCTCTCCGTCGTCGGCTCCTGGCTCGGCTTC
CGCAGCCCGCGCGTCGAGCCGCCGGTCCGGACGAACCAGATCCCGCGCCAGATCCCGCCCGTCACCACCTACCTC
AAGCCCATCCCCAGCATGCTCATCGTCGGCCTGCTGCCCTTTGGCGCCATCTTCGTCGAGCTGTACTTCATCCTG
AGCTCCATCTGGTTCAGCCGCATCTACTACATGTTCGGCTTCCTCTTCCTCTGCTACGGCCTGATGATTGTCGTC
TGCGCCGCCGTCACCATCCTCATGACCTACTTCTTGCTGTGCGCCGAGAACTACAACTGGCAGTGGCGCTCCTTC
CTCGCCGCCGGCATGAGCGGCGGCTACATCTTCTTCAACTGCCTGCTCTACCTCCTGACCAAGGTCAAGCTCAGC
AGCCTCGCCGGCGTCGTGCTCTACGTCGGCTACAGCGCCCTCATCTCCTTCATGTTCTTCATCCTCGCCGGTAAG
CCAACCCCCCACCCCGACGGCTCTCTACTGGGTGTCGCGCGCACGATGCTGACGTTGCCTCCCGCAGGCTCTATT
GGCTACTTTGCTAGCTGGTGGTTCGTGAGGAAGATTTACGCCTCTATCAAGATTGACTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail