Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|45
Gene name
LocationContig_1001:7529..9505
Strand-
Gene length (bp)1976
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 1.2E-55 85 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42916|ALE1_SCHPO Lysophospholipid acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ale1 PE=1 SV=1 5 482 3.0E-123
sp|Q08548|ALE1_YEAST Lysophospholipid acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALE1 PE=1 SV=1 17 422 1.0E-112
sp|Q5ZKL6|MBOA2_CHICK Membrane-bound O-acyltransferase domain-containing protein 2 OS=Gallus gallus GN=mboat2 PE=2 SV=1 48 499 2.0E-46
sp|Q6ZWT7|MBOA2_HUMAN Lysophospholipid acyltransferase 2 OS=Homo sapiens GN=MBOAT2 PE=2 SV=2 48 421 3.0E-44
sp|Q8R3I2|MBOA2_MOUSE Lysophospholipid acyltransferase 2 OS=Mus musculus GN=Mboat2 PE=1 SV=1 59 421 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42916|ALE1_SCHPO Lysophospholipid acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ale1 PE=1 SV=1 5 482 3.0E-123
sp|Q08548|ALE1_YEAST Lysophospholipid acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALE1 PE=1 SV=1 17 422 1.0E-112
sp|Q5ZKL6|MBOA2_CHICK Membrane-bound O-acyltransferase domain-containing protein 2 OS=Gallus gallus GN=mboat2 PE=2 SV=1 48 499 2.0E-46
sp|Q6ZWT7|MBOA2_HUMAN Lysophospholipid acyltransferase 2 OS=Homo sapiens GN=MBOAT2 PE=2 SV=2 48 421 3.0E-44
sp|Q8R3I2|MBOA2_MOUSE Lysophospholipid acyltransferase 2 OS=Mus musculus GN=Mboat2 PE=1 SV=1 59 421 1.0E-41
sp|F4IDU4|MBOA1_ARATH Lysophospholipid acyltransferase 1 OS=Arabidopsis thaliana GN=LPLAT1 PE=1 SV=1 61 423 3.0E-41
sp|Q9CAN8|MBOA2_ARATH Lysophospholipid acyltransferase 2 OS=Arabidopsis thaliana GN=LPLAT2 PE=1 SV=1 62 431 4.0E-41
sp|Q3T1J2|MBOA2_RAT Membrane-bound O-acyltransferase domain-containing protein 2 OS=Rattus norvegicus GN=Mboat2 PE=2 SV=2 59 416 1.0E-40
sp|Q8BH98|MBOA1_MOUSE Lysophospholipid acyltransferase 1 OS=Mus musculus GN=Mboat1 PE=1 SV=1 63 422 7.0E-38
sp|Q91V01|MBOA5_MOUSE Lysophospholipid acyltransferase 5 OS=Mus musculus GN=Lpcat3 PE=1 SV=1 12 423 6.0E-37
sp|Q6P1A2|MBOA5_HUMAN Lysophospholipid acyltransferase 5 OS=Homo sapiens GN=LPCAT3 PE=1 SV=1 12 423 1.0E-35
sp|Q6ZNC8|MBOA1_HUMAN Lysophospholipid acyltransferase 1 OS=Homo sapiens GN=MBOAT1 PE=1 SV=1 63 422 3.0E-35
sp|Q5FVN0|MBOA5_RAT Lysophospholipid acyltransferase 5 OS=Rattus norvegicus GN=Lpcat3 PE=2 SV=1 12 423 1.0E-34
sp|Q3SZL3|MBOA5_BOVIN Lysophospholipid acyltransferase 5 OS=Bos taurus GN=LPCAT3 PE=2 SV=1 79 423 8.0E-34
sp|Q9VVX5|MBOA5_DROME Lysophospholipid acyltransferase 5 OS=Drosophila melanogaster GN=nes PE=1 SV=1 62 471 4.0E-26
sp|Q7SZQ0|MBOA7_DANRE Lysophospholipid acyltransferase 7 OS=Danio rerio GN=mboat7 PE=2 SV=1 93 432 2.0E-23
sp|O01925|MBOA5_CAEEL Lysophospholipid acyltransferase 5 OS=Caenorhabditis elegans GN=mboa-6 PE=1 SV=2 11 349 1.0E-20
sp|Q8CHK3|MBOA7_MOUSE Lysophospholipid acyltransferase 7 OS=Mus musculus GN=Mboat7 PE=1 SV=1 113 425 2.0E-18
sp|Q0VCY6|MBOA7_BOVIN Lysophospholipid acyltransferase 7 OS=Bos taurus GN=MBOAT7 PE=2 SV=1 113 421 2.0E-17
sp|Q96N66|MBOA7_HUMAN Lysophospholipid acyltransferase 7 OS=Homo sapiens GN=MBOAT7 PE=1 SV=2 113 421 2.0E-16
sp|Q5U4T9|MBOA7_XENLA Lysophospholipid acyltransferase 7 OS=Xenopus laevis GN=mboat7 PE=2 SV=1 113 421 1.0E-15
sp|A8WXS4|MBOA7_CAEBR Lysophospholipid acyltransferase 7 OS=Caenorhabditis briggsae GN=mboa-7 PE=3 SV=1 93 440 7.0E-13
sp|B1Q006|MBOA4_DANRE Ghrelin O-acyltransferase OS=Danio rerio GN=mboat4 PE=2 SV=1 79 368 4.0E-12
sp|Q19468|MBOA7_CAEEL Lysophospholipid acyltransferase 7 OS=Caenorhabditis elegans GN=mboa-7 PE=1 SV=2 93 439 6.0E-12
sp|P0C7A3|MBOA4_MOUSE Ghrelin O-acyltransferase OS=Mus musculus GN=Mboat4 PE=1 SV=1 94 355 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 132 154 22
3 185 207 22
4 246 268 22
5 337 359 22
6 387 409 22
7 416 438 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|45
MLQNINRPFEALSATTGASADEIKIIFSFLLSYPLAGLLKRIPDTRPGLKNLFIICPYMPWIGFVFLMCHMSVNH
VRRQTANDSSSVDITGAQMVLVMKLSAFCWNVADGQLQNDRLSEFQKDHALGDLPPVLDFAAYVLFFPALLAGPA
FDYIEYRRWIDTSMFDVPPEIDAAKRPPVRKRRKIPRSGTPATLKALLGLIWIALFVSLSSRFSPEKLVAQSYLQ
YGLARRIWIMYMANLVARFKYYGVWTLAEGSCILAGLGYNGVDPVTGKVAWNRLRNIDPWAVETAQNPRGYLAGW
NINTNNWLRNYVYLRVTPRGKKPGFRATMTTFVTSALWHGFYPGYYLTFVLASLIQTVAKNFRRTVRPFFLDPMV
EGPGPGKTCYDVIGYIATQFTFSFATTPFLLLNMSDSLRAWSGVYFYGLFGTLACLGFFSSSAKTLLRMRLDERQ
GKAHAKLVRSVSTESLTEKEPILGISKDLEQDMSEAMEEIRAEVQTRQRKVLHILD*
Coding >Hirsu2|45
ATGCTTCAGAATATTAATCGGCCTTTCGAGGCTCTCTCGGCTACAACTGGCGCCTCTGCAGATGAGATTAAAATC
ATCTTCTCTTTTCTACTGTCCTACCCACTGGCTGGGCTACTGAAGCGGATTCCGGATACGAGACCGGGACTGAAA
AACCTATTTATCATATGTCCGTACATGCCCTGGATTGGCTTTGTGTTTCTCATGTGCCATATGTCTGTGAATCAC
GTGCGACGTCAGACGGCCAACGACTCGTCGTCAGTCGATATTACAGGAGCTCAGATGGTTCTGGTCATGAAACTC
AGTGCATTTTGTTGGAATGTCGCCGACGGGCAGCTCCAAAACGACAGGCTATCAGAATTTCAGAAGGACCACGCC
CTTGGCGATCTGCCTCCCGTCCTAGACTTCGCAGCATATGTTCTCTTCTTCCCAGCCCTACTTGCTGGCCCTGCT
TTCGACTACATCGAATACCGTCGCTGGATTGATACTTCGATGTTCGATGTCCCGCCTGAAATCGACGCTGCGAAA
CGACCTCCTGTGAGAAAGAGACGCAAAATTCCTCGAAGCGGCACTCCTGCCACACTCAAGGCTCTTCTTGGGCTA
ATATGGATAGCTTTGTTCGTCTCACTTTCATCTCGCTTCAGCCCCGAGAAGTTGGTAGCGCAGTCGTATCTGCAA
TATGGGCTTGCCCGGCGCATCTGGATCATGTACATGGCGAATCTTGTGGCCAGATTCAAGTACTACGGCGTCTGG
ACTTTGGCCGAAGGTTCCTGCATCCTTGCAGGCCTCGGCTACAACGGAGTTGATCCTGTCACCGGTAAAGTGGCG
TGGAATCGTCTGCGAAATATCGATCCATGGGCTGTGGAAACGGCCCAGAATCCCCGAGGTTACCTAGCCGGCTGG
AACATAAACACAAACAACTGGCTGAGAAATTATGTCTACCTTCGCGTGACACCGAGAGGCAAAAAACCGGGATTT
CGAGCCACAATGACTACCTTCGTCACCAGCGCTCTCTGGCACGGCTTTTACCCCGGGTATTACTTGACATTCGTC
TTGGCAAGCCTGATTCAAACGGTTGCCAAAAACTTTCGACGCACCGTCCGACCATTTTTCCTGGATCCAATGGTC
GAGGGGCCAGGGCCAGGCAAGACCTGCTATGATGTCATTGGTTATATCGCAACCCAATTCACGTTCTCCTTTGCC
ACAACCCCTTTCCTACTCCTCAACATGTCCGACTCCTTACGTGCCTGGTCTGGCGTTTATTTCTATGGACTTTTC
GGAACACTTGCCTGCCTGGGCTTTTTTTCTTCCTCGGCGAAGACTTTACTGAGGATGAGGTTGGATGAAAGACAG
GGCAAGGCTCATGCTAAGTTAGTAAGATCCGTGAGTACAGAAAGTCTTACAGAAAAGGAGCCCATACTTGGCATC
TCTAAGGACCTTGAGCAAGATATGAGTGAGGCTATGGAGGAGATCCGGGCCGAAGTTCAAACCCGTCAGCGAAAG
GTTCTACACATCCTCGACTGA
Transcript >Hirsu2|45
ATGCTTCAGAATATTAATCGGCCTTTCGAGGCTCTCTCGGCTACAACTGGCGCCTCTGCAGATGAGATTAAAATC
ATCTTCTCTTTTCTACTGTCCTACCCACTGGCTGGGCTACTGAAGCGGATTCCGGATACGAGACCGGGACTGAAA
AACCTATTTATCATATGTCCGTACATGCCCTGGATTGGCTTTGTGTTTCTCATGTGCCATATGTCTGTGAATCAC
GTGCGACGTCAGACGGCCAACGACTCGTCGTCAGTCGATATTACAGGAGCTCAGATGGTTCTGGTCATGAAACTC
AGTGCATTTTGTTGGAATGTCGCCGACGGGCAGCTCCAAAACGACAGGCTATCAGAATTTCAGAAGGACCACGCC
CTTGGCGATCTGCCTCCCGTCCTAGACTTCGCAGCATATGTTCTCTTCTTCCCAGCCCTACTTGCTGGCCCTGCT
TTCGACTACATCGAATACCGTCGCTGGATTGATACTTCGATGTTCGATGTCCCGCCTGAAATCGACGCTGCGAAA
CGACCTCCTGTGAGAAAGAGACGCAAAATTCCTCGAAGCGGCACTCCTGCCACACTCAAGGCTCTTCTTGGGCTA
ATATGGATAGCTTTGTTCGTCTCACTTTCATCTCGCTTCAGCCCCGAGAAGTTGGTAGCGCAGTCGTATCTGCAA
TATGGGCTTGCCCGGCGCATCTGGATCATGTACATGGCGAATCTTGTGGCCAGATTCAAGTACTACGGCGTCTGG
ACTTTGGCCGAAGGTTCCTGCATCCTTGCAGGCCTCGGCTACAACGGAGTTGATCCTGTCACCGGTAAAGTGGCG
TGGAATCGTCTGCGAAATATCGATCCATGGGCTGTGGAAACGGCCCAGAATCCCCGAGGTTACCTAGCCGGCTGG
AACATAAACACAAACAACTGGCTGAGAAATTATGTCTACCTTCGCGTGACACCGAGAGGCAAAAAACCGGGATTT
CGAGCCACAATGACTACCTTCGTCACCAGCGCTCTCTGGCACGGCTTTTACCCCGGGTATTACTTGACATTCGTC
TTGGCAAGCCTGATTCAAACGGTTGCCAAAAACTTTCGACGCACCGTCCGACCATTTTTCCTGGATCCAATGGTC
GAGGGGCCAGGGCCAGGCAAGACCTGCTATGATGTCATTGGTTATATCGCAACCCAATTCACGTTCTCCTTTGCC
ACAACCCCTTTCCTACTCCTCAACATGTCCGACTCCTTACGTGCCTGGTCTGGCGTTTATTTCTATGGACTTTTC
GGAACACTTGCCTGCCTGGGCTTTTTTTCTTCCTCGGCGAAGACTTTACTGAGGATGAGGTTGGATGAAAGACAG
GGCAAGGCTCATGCTAAGTTAGTAAGATCCGTGAGTACAGAAAGTCTTACAGAAAAGGAGCCCATACTTGGCATC
TCTAAGGACCTTGAGCAAGATATGAGTGAGGCTATGGAGGAGATCCGGGCCGAAGTTCAAACCCGTCAGCGAAAG
GTTCTACACATCCTCGACTGA
Gene >Hirsu2|45
ATGCTTCAGAATATTAATCGGCGTCAGTATCATATTCCCTATTTTAACCCTGCCGCCAACTGACCTCAGTGCGTC
CGTGCAGCTTTCGAGGCTCTCTCGGCTACAACTGGCGCCTCTGCAGATGAGAGTAACGGCCCACGCCCCCCGAAT
TCTTACTTCTTCCTGCTACTGTGACTTGGCTGACGCCTCCTTCGCCAACCTCACCAGTTAAAATCATCTTCTCTT
TTCTACTGTCCTACCCACTGGCTGGGCTACTGAAGCGGATTCCGGATACGAGACCGGGACTGAAAAACCTATTTA
TCATATGGTATGTTTGCCACTGAATCCCAATGGTCCCCATCCCGTCAAAACCTGAAAGTCTATGTTTTCTTTTCT
TTTCAGCCCATTGTTGACCCATCTGCGCTCGTAACAGCAACTCGGTCTTCTACCTTGTCGGCCTCTTTGACCTAT
GGCGTGGCTTGGTGACCCTATTCATCAGTTCGGCGGTCACATTTTGCATTGCTAAATACTTGCGACGCAGTCCGT
ACATGCCCTGGATTGGCTTTGTGTTTCTCATGTGCCATATGTCTGTGAATCACGTGCGACGTCAGACGGCCAACG
ACTCGTCGTCAGTCGATATTACAGGAGCTCAGATGGTTCTGGTCATGAAACTCAGTGCATTTTGTTGGAATGTCG
CCGACGGGCAGCTCCAAAACGACAGGCTATCAGAATTTCAGAAGGACCACGCCCTTGGCGATCTGCCTCCCGTCC
TAGACTTCGCAGCATATGTTCTCTTCTTCCCAGCCCTACTTGCTGGCCCTGCTTTCGACTACATCGAATACCGTC
GCTGGATTGATACTTCGATGTTCGATGTCCCGCCTGAAATCGACGCTGCGAAACGACCTCCTGTGAGAAAGAGAC
GCAAAATTCCTCGAAGCGGCACTCCTGCCACACTCAAGGCTCTTCTTGGGCTAATATGGATAGCTTTGTTCGTCT
CACTTTCATCTCGCTTCAGCCCCGAGAAGTTGGTAGCGCAGTCGTATCTGCAATATGGGCTTGCCCGGCGCATCT
GGATCATGTACATGGCGAATCTTGTGGCCAGATTCAAGTACTACGGCGTCTGGACTTTGGCCGAAGGTTCCTGCA
TCCTTGCAGGCCTCGGCTACAACGGAGTTGATCCTGTCACCGGTAAAGTGGCGTGGAATCGTCTGCGAAATATCG
ATCCATGGGCTGTGGAAACGGCCCAGAATCCCCGAGGTTACCTAGCCGGCTGGAACATAAACACAAACAACTGGC
TGAGAAATTATGTCTACCTTCGCGTGACACCGAGAGGCAAAAAACCGGGATTTCGAGCCACAATGACTACCTTCG
TCACCAGCGCTCTCTGGCACGGCTTTTACCCCGGGTATTACTTGACATTCGTCTTGGCAAGCCTGATTCAAACGG
TTGCCAAAAGTAAGTAAAATGCATTCAGCCTTGCCCGTCTGGCAGCTCTATGCGACCCCGACGTGTTCGGAAACG
GCCTCTCTTGATCATGTACTAAAGCTCAGTTTCTAGACTTTCGACGCACCGTCCGACCATTTTTCCTGGATCCAA
TGGTCGAGGGGCCAGGGCCAGGCAAGACCTGCTATGATGTCATTGGTTATATCGCAACCCAATTCACGTTCTCCT
TTGCCACAACCCCTTTCCTACTCCTCAACATGTCCGACTCCTTACGTGCCTGGTCTGGCGTTTATTTCTATGGAC
TTTTCGGAACACTTGCCTGCCTGGGCTTTTTTTCTTCCTCGGCGAAGACTTTACTGAGGATGAGGTTGGATGAAA
GACAGGGCAAGGCTCATGCTAAGTTAGTAAGATCCGTGAGTACAGAAAGTCTTACAGAAAAGGAGCCCATACTTG
GCATCTCTAAGGACCTTGAGCAAGATATGAGTGAGGCTATGGAGGAGATCCGGGCCGAAGTTCAAACCCGTCAGC
GAAAGGTTCTACACATCCTCGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail