Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4489
Gene name
LocationContig_2286:459..2646
Strand+
Gene length (bp)2187
Transcript length (bp)2070
Coding sequence length (bp)2070
Protein length (aa) 690

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 3.7E-22 253 541
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.0E-15 254 477
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 2.0E-11 140 416

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 67 688 0.0E+00
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 96 534 2.0E-12
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 281 583 6.0E-12
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 254 551 4.0E-11
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 254 575 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 67 688 0.0E+00
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 96 534 2.0E-12
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 281 583 6.0E-12
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 254 551 4.0E-11
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 254 575 5.0E-11
sp|Q07755|NODC_AZOC5 N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodC PE=3 SV=2 140 530 9.0E-11
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 128 456 1.0E-10
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 253 549 2.0E-10
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 254 428 2.0E-10
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 253 426 2.0E-10
sp|P0C0H1|HASA_STRP1 Hyaluronan synthase OS=Streptococcus pyogenes serotype M1 GN=hasA PE=3 SV=1 141 531 2.0E-10
sp|P0C0H0|HASA_STRPY Hyaluronan synthase OS=Streptococcus pyogenes GN=hasA PE=3 SV=1 141 531 3.0E-10
sp|Q8NKX1|HASA_STRP8 Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=hasA PE=3 SV=1 141 531 3.0E-10
sp|Q5X9A9|HASA_STRP6 Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=hasA PE=3 SV=1 141 531 3.0E-10
sp|P0DB61|HASA_STRPQ Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hasA PE=3 SV=1 141 531 3.0E-10
sp|P0DB60|HASA_STRP3 Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hasA PE=3 SV=1 141 531 3.0E-10
sp|P50356|NODC_RHIGA N-acetylglucosaminyltransferase OS=Rhizobium galegae GN=nodC PE=3 SV=1 125 549 4.0E-10
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 254 534 4.0E-10
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 255 534 4.0E-10
sp|Q92819|HYAS2_HUMAN Hyaluronan synthase 2 OS=Homo sapiens GN=HAS2 PE=2 SV=1 142 456 7.0E-10
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 254 552 1.0E-09
sp|O97711|HYAS2_BOVIN Hyaluronan synthase 2 OS=Bos taurus GN=HAS2 PE=2 SV=1 142 456 1.0E-09
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 306 473 3.0E-09
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 253 428 5.0E-09
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 280 456 2.0E-08
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 306 432 2.0E-08
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 280 430 2.0E-08
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 306 488 7.0E-07
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 306 483 8.0E-07
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 306 488 1.0E-06
sp|O57428|HASR_XENLA Hyaluronan synthase-related protein OS=Xenopus laevis GN=has-rs PE=1 SV=2 128 467 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 71 22
3 98 120 22
4 452 469 17
5 474 493 19
6 500 522 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4489
MAVSDKWPVQDIAYTSIVGVVMLMAFLEWFLWFAAFLYCLFKVFRKAEHWSIRILCILVGMAFALLRFIFLPIMV
VTLPLPGQVSRHWPQSIVSFLQWFAFWSFAILLTVPWLFCIYQLVTNQLGRTKRIKRVLDDVTAPKVVIVMPCYR
EEPDVLIKAIDSVVNCDYPPACIHVFLSFDGEQVDDLYLNTTEKLGVPAFMGAYPRSIDVSYKAARVTISRFPHG
GKRHCQKSTFKLIDRVYAEYLKRNDNLFILFIDSDCILDKVCLQNFVYDMELSPGNSRDMLAMTGVITSTTRKHS
IITLLQDMEYIHGQLFERTVESGCGSVTCLPGALTMLRFSAFRRMAKYYFADKPEQCDDLFDFAKCHLGEDRWLT
HLFMIGAKKRHQIQMCTSAFCKTEAVQTYRSLVKQRRRWFLGFITNEVCMLTDWRLWKRYPTLIVVRFMQNTIRT
TALLFFIMVLALLTTVVKVNNLPVGFIAVSLGLNWLLMLYFGAKLRRFKVWLYPLMFVLNPFFNWYYMVYGIFTA
GQRTWGGPRADATAADSNTTAREAAEQAERQGDELNVVPESFKPAQEARRAASKSQSRTVVLGRKRSVVRPPNKI
DGKFSARQRTAAGIYAHPDEAEANSILMAGAASLRPHSWASNWHDSLDSLESCRADEKTHIPVQMGRFMGEEDRR
KYEIAQQAQLQRTG*
Coding >Hirsu2|4489
ATGGCCGTTTCCGACAAGTGGCCTGTCCAAGACATTGCTTACACCTCCATCGTCGGGGTTGTCATGCTCATGGCA
TTTCTCGAGTGGTTTCTTTGGTTTGCGGCGTTCCTGTATTGTCTCTTCAAGGTCTTCCGCAAGGCGGAGCATTGG
TCCATTCGCATCCTCTGCATCCTCGTAGGCATGGCGTTTGCCCTACTGCGCTTCATCTTTTTGCCCATTATGGTG
GTGACGCTGCCGCTACCCGGCCAAGTGTCGAGACACTGGCCTCAGAGTATCGTCTCCTTTCTGCAATGGTTTGCC
TTCTGGAGTTTCGCAATTCTTTTGACGGTTCCCTGGCTGTTCTGCATCTATCAGCTTGTGACGAACCAATTGGGT
CGCACCAAGCGTATCAAGCGTGTGCTAGACGACGTCACCGCTCCTAAAGTGGTCATCGTCATGCCTTGCTACCGG
GAAGAGCCCGATGTCCTGATCAAGGCCATCGACTCTGTCGTCAACTGCGACTACCCGCCGGCCTGCATTCACGTG
TTCCTCTCATTTGACGGGGAGCAGGTAGACGACCTCTACCTCAACACGACTGAAAAACTCGGAGTGCCGGCTTTC
ATGGGGGCGTATCCAAGAAGCATCGACGTGTCCTACAAAGCGGCCCGGGTCACCATCTCGCGTTTCCCTCATGGC
GGCAAACGACACTGCCAAAAGTCCACATTCAAACTCATCGACAGAGTCTATGCGGAATATCTCAAGAGAAACGAC
AATCTGTTCATCCTCTTTATCGACTCGGACTGCATACTGGACAAGGTCTGCTTGCAGAACTTTGTATACGACATG
GAGCTCAGCCCGGGAAACTCCAGAGACATGCTGGCCATGACTGGCGTCATCACGTCAACAACCCGAAAGCACAGC
ATCATCACACTGCTCCAGGACATGGAGTATATCCATGGCCAGCTGTTTGAGCGCACAGTCGAGTCAGGGTGCGGC
TCCGTGACGTGCCTTCCGGGGGCGTTGACGATGCTCCGTTTCTCGGCCTTCCGGAGGATGGCCAAGTACTACTTC
GCGGACAAGCCGGAGCAGTGCGACGATCTTTTCGACTTTGCTAAATGCCACCTGGGCGAGGATCGGTGGCTCACC
CATCTTTTCATGATCGGTGCCAAGAAACGACACCAGATCCAAATGTGCACGTCGGCCTTTTGCAAGACTGAGGCT
GTGCAGACCTATCGGTCACTGGTTAAGCAGCGGCGTCGATGGTTCTTGGGCTTCATCACCAACGAGGTCTGCATG
CTGACCGACTGGCGGCTGTGGAAGCGGTATCCGACACTGATTGTGGTGCGGTTCATGCAGAACACGATCCGGACA
ACGGCATTGCTATTCTTCATCATGGTCTTGGCTCTCCTGACGACGGTGGTCAAGGTGAACAACCTACCCGTCGGT
TTCATTGCCGTTTCGCTGGGCCTCAATTGGCTCCTGATGCTCTACTTTGGGGCGAAGTTGCGTCGGTTCAAGGTC
TGGCTGTACCCGCTCATGTTCGTCCTGAACCCCTTCTTCAACTGGTACTACATGGTCTACGGGATCTTCACCGCA
GGCCAACGGACGTGGGGCGGACCCCGGGCCGATGCGACGGCGGCCGACAGCAACACAACCGCCCGGGAGGCGGCG
GAGCAGGCAGAGCGACAAGGAGACGAGCTTAACGTCGTGCCCGAGTCGTTCAAGCCGGCGCAGGAGGCGCGGAGA
GCCGCAAGCAAGTCGCAGTCGCGGACAGTCGTGCTCGGGCGTAAGAGGAGTGTCGTCAGACCCCCCAACAAGATC
GACGGCAAATTTTCAGCGCGACAGCGGACAGCAGCAGGCATCTATGCACATCCGGACGAGGCGGAAGCGAACTCG
ATCCTCATGGCCGGAGCGGCGTCTCTGCGACCGCACAGCTGGGCCAGCAACTGGCATGACTCACTAGACAGCCTC
GAATCCTGCCGGGCGGACGAGAAAACACATATCCCTGTGCAGATGGGGAGGTTTATGGGGGAGGAGGACCGCCGC
AAGTATGAAATTGCGCAGCAAGCCCAACTACAGCGCACAGGCTGA
Transcript >Hirsu2|4489
ATGGCCGTTTCCGACAAGTGGCCTGTCCAAGACATTGCTTACACCTCCATCGTCGGGGTTGTCATGCTCATGGCA
TTTCTCGAGTGGTTTCTTTGGTTTGCGGCGTTCCTGTATTGTCTCTTCAAGGTCTTCCGCAAGGCGGAGCATTGG
TCCATTCGCATCCTCTGCATCCTCGTAGGCATGGCGTTTGCCCTACTGCGCTTCATCTTTTTGCCCATTATGGTG
GTGACGCTGCCGCTACCCGGCCAAGTGTCGAGACACTGGCCTCAGAGTATCGTCTCCTTTCTGCAATGGTTTGCC
TTCTGGAGTTTCGCAATTCTTTTGACGGTTCCCTGGCTGTTCTGCATCTATCAGCTTGTGACGAACCAATTGGGT
CGCACCAAGCGTATCAAGCGTGTGCTAGACGACGTCACCGCTCCTAAAGTGGTCATCGTCATGCCTTGCTACCGG
GAAGAGCCCGATGTCCTGATCAAGGCCATCGACTCTGTCGTCAACTGCGACTACCCGCCGGCCTGCATTCACGTG
TTCCTCTCATTTGACGGGGAGCAGGTAGACGACCTCTACCTCAACACGACTGAAAAACTCGGAGTGCCGGCTTTC
ATGGGGGCGTATCCAAGAAGCATCGACGTGTCCTACAAAGCGGCCCGGGTCACCATCTCGCGTTTCCCTCATGGC
GGCAAACGACACTGCCAAAAGTCCACATTCAAACTCATCGACAGAGTCTATGCGGAATATCTCAAGAGAAACGAC
AATCTGTTCATCCTCTTTATCGACTCGGACTGCATACTGGACAAGGTCTGCTTGCAGAACTTTGTATACGACATG
GAGCTCAGCCCGGGAAACTCCAGAGACATGCTGGCCATGACTGGCGTCATCACGTCAACAACCCGAAAGCACAGC
ATCATCACACTGCTCCAGGACATGGAGTATATCCATGGCCAGCTGTTTGAGCGCACAGTCGAGTCAGGGTGCGGC
TCCGTGACGTGCCTTCCGGGGGCGTTGACGATGCTCCGTTTCTCGGCCTTCCGGAGGATGGCCAAGTACTACTTC
GCGGACAAGCCGGAGCAGTGCGACGATCTTTTCGACTTTGCTAAATGCCACCTGGGCGAGGATCGGTGGCTCACC
CATCTTTTCATGATCGGTGCCAAGAAACGACACCAGATCCAAATGTGCACGTCGGCCTTTTGCAAGACTGAGGCT
GTGCAGACCTATCGGTCACTGGTTAAGCAGCGGCGTCGATGGTTCTTGGGCTTCATCACCAACGAGGTCTGCATG
CTGACCGACTGGCGGCTGTGGAAGCGGTATCCGACACTGATTGTGGTGCGGTTCATGCAGAACACGATCCGGACA
ACGGCATTGCTATTCTTCATCATGGTCTTGGCTCTCCTGACGACGGTGGTCAAGGTGAACAACCTACCCGTCGGT
TTCATTGCCGTTTCGCTGGGCCTCAATTGGCTCCTGATGCTCTACTTTGGGGCGAAGTTGCGTCGGTTCAAGGTC
TGGCTGTACCCGCTCATGTTCGTCCTGAACCCCTTCTTCAACTGGTACTACATGGTCTACGGGATCTTCACCGCA
GGCCAACGGACGTGGGGCGGACCCCGGGCCGATGCGACGGCGGCCGACAGCAACACAACCGCCCGGGAGGCGGCG
GAGCAGGCAGAGCGACAAGGAGACGAGCTTAACGTCGTGCCCGAGTCGTTCAAGCCGGCGCAGGAGGCGCGGAGA
GCCGCAAGCAAGTCGCAGTCGCGGACAGTCGTGCTCGGGCGTAAGAGGAGTGTCGTCAGACCCCCCAACAAGATC
GACGGCAAATTTTCAGCGCGACAGCGGACAGCAGCAGGCATCTATGCACATCCGGACGAGGCGGAAGCGAACTCG
ATCCTCATGGCCGGAGCGGCGTCTCTGCGACCGCACAGCTGGGCCAGCAACTGGCATGACTCACTAGACAGCCTC
GAATCCTGCCGGGCGGACGAGAAAACACATATCCCTGTGCAGATGGGGAGGTTTATGGGGGAGGAGGACCGCCGC
AAGTATGAAATTGCGCAGCAAGCCCAACTACAGCGCACAGGCTGA
Gene >Hirsu2|4489
ATGGCCGTTTCCGACAAGTGGCCTGTCCAAGACGTATGTCGCTGCGCCGCTCACTTTCTACTTTGTCCAGGACTG
AACGACTGATGGGGTTTCAGATTGCTTACACCTCCATCGTCGGGGTTGTCATGCTCATGGCATTTCTCGAGTGGT
TTCTTTGGTTTGCGGCGTTCCTGTATTGTCTCTTCAAGGTCTTCCGCAAGGCGGAGCATTGGTCCATTCGCATCC
TCTGCATCCTCGTAGGCATGGCGTTTGCCCTACTGCGGTATAGTTCTCCTCTTCAATCGAACTGAGTTGGGCGGC
TAAAGTGCATCTTGCAGCTTCATCTTTTTGCCCATTATGGTGGTGACGCTGCCGCTACCCGGCCAAGTGTCGAGA
CACTGGCCTCAGAGTATCGTCTCCTTTCTGCAATGGTTTGCCTTCTGGAGTTTCGCAATTCTTTTGACGGTTCCC
TGGCTGTTCTGCATCTATCAGCTTGTGACGAACCAATTGGGTCGCACCAAGCGTATCAAGCGTGTGCTAGACGAC
GTCACCGCTCCTAAAGTGGTCATCGTCATGCCTTGCTACCGGGAAGAGCCCGATGTCCTGATCAAGGCCATCGAC
TCTGTCGTCAACTGCGACTACCCGCCGGCCTGCATTCACGTGTTCCTCTCATTTGACGGGGAGCAGGTAGACGAC
CTCTACCTCAACACGACTGAAAAACTCGGAGTGCCGGCTTTCATGGGGGCGTATCCAAGAAGCATCGACGTGTCC
TACAAAGCGGCCCGGGTCACCATCTCGCGTTTCCCTCATGGCGGCAAACGACACTGCCAAAAGTCCACATTCAAA
CTCATCGACAGAGTCTATGCGGAATATCTCAAGAGAAACGACAATCTGTTCATCCTCTTTATCGACTCGGACTGC
ATACTGGACAAGGTCTGCTTGCAGAACTTTGTATACGACATGGAGCTCAGCCCGGGAAACTCCAGAGACATGCTG
GCCATGACTGGCGTCATCACGTCAACAACCCGAAAGCACAGCATCATCACACTGCTCCAGGACATGGAGTATATC
CATGGCCAGCTGTTTGAGCGCACAGTCGAGTCAGGGTGCGGCTCCGTGACGTGCCTTCCGGGGGCGTTGACGATG
CTCCGTTTCTCGGCCTTCCGGAGGATGGCCAAGTACTACTTCGCGGACAAGCCGGAGCAGTGCGACGATCTTTTC
GACTTTGCTAAATGCCACCTGGGCGAGGATCGGTGGCTCACCCATCTTTTCATGATCGGTGCCAAGAAACGACAC
CAGATCCAAATGTGCACGTCGGCCTTTTGCAAGACTGAGGCTGTGCAGACCTATCGGTCACTGGTTAAGCAGCGG
CGTCGATGGTTCTTGGGCTTCATCACCAACGAGGTCTGCATGCTGACCGACTGGCGGCTGTGGAAGCGGTATCCG
ACACTGATTGTGGTGCGGTTCATGCAGAACACGATCCGGACAACGGCATTGCTATTCTTCATCATGGTCTTGGCT
CTCCTGACGACGGTGGTCAAGGTGAACAACCTACCCGTCGGTTTCATTGCCGTTTCGCTGGGCCTCAATTGGCTC
CTGATGCTCTACTTTGGGGCGAAGTTGCGTCGGTTCAAGGTCTGGCTGTACCCGCTCATGTTCGTCCTGAACCCC
TTCTTCAACTGGTACTACATGGTCTACGGGATCTTCACCGCAGGCCAACGGACGTGGGGCGGACCCCGGGCCGAT
GCGACGGCGGCCGACAGCAACACAACCGCCCGGGAGGCGGCGGAGCAGGCAGAGCGACAAGGAGACGAGCTTAAC
GTCGTGCCCGAGTCGTTCAAGCCGGCGCAGGAGGCGCGGAGAGCCGCAAGCAAGTCGCAGTCGCGGACAGTCGTG
CTCGGGCGTAAGAGGAGTGTCGTCAGACCCCCCAACAAGATCGACGGCAAATTTTCAGCGCGACAGCGGACAGCA
GCAGGCATCTATGCACATCCGGACGAGGCGGAAGCGAACTCGATCCTCATGGCCGGAGCGGCGTCTCTGCGACCG
CACAGCTGGGCCAGCAACTGGCATGACTCACTAGACAGCCTCGAATCCTGCCGGGCGGACGAGAAAACACATATC
CCTGTGCAGATGGGGAGGTTTATGGGGGAGGAGGACCGCCGCAAGTATGAAATTGCGCAGCAAGCCCAACTACAG
CGCACAGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail