Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4481
Gene name
LocationContig_2280:301..2316
Strand-
Gene length (bp)2015
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13418 Kelch_4 Galactose oxidase, central domain 2.9E-05 312 389
PF13415 Kelch_3 Galactose oxidase, central domain 6.9E-09 267 319

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P15258|RAL2_SCHPO Protein ral2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ral2 PE=1 SV=1 255 646 3.0E-39
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 213 405 3.0E-09
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 250 331 1.0E-06
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 250 339 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4481
MAHHLTGLTGSQNPPRRSSRARSVANDPQPPSDRDSPDGSPGSHPRPGRSPRPRLPRKNSAPGLTDPGSSLPANG
RTPPYATSQHARQLSLQHSLAKPLPQTPPHPAAANQPTHPADALHLAVLSDADLRAEHSPSRPTDSAMDGRTSTM
DSASSAASAAPFPGGPDQYVQDMSSSLSSIGSSARRDSNADEPRMPLSARSNGTNHSAGPSPAATQSRSHAAAAS
GLHVGGPSRGSSAHLSGLMCNVHRTTGREPPPLVGATTTILGDKLYVFGGRVLSRSRPAPLTANLYELDLIRRHW
SKLDTSGDLPPPRYFHSMCPLGDTKIVCYGGMSPSSNQPTGADQQQQQPQPQPQPQPDQPKQSQPQQPEVTVMSD
IYIYDVPTKKWTYVPAQDAPQGRYAHCACVLPSSATFSSARAPLSALQHNPSTGNPGEGQIGINIDGSGGAEMVV
VGGQDGGNHYIEQISVFNLRSLKWTSTQPLGKSCGAYRSVTAPLTPSMASRIGRASQQASQRPDAAAAAAGAGPD
ARDPGSSMLIYSNYNFLDVKLELQIRSSDGSLTERPMSGTYSPPGLRFPNGGVIDTHFVVSGTYLTSSKQEYALW
ALDLRTLTWSRIDAGGSVFSQGSWNRGVLWNRRNTFVILGNRKRSLRLL*
Coding >Hirsu2|4481
ATGGCCCACCACCTCACAGGACTGACCGGCTCGCAGAACCCGCCTCGTCGCTCCTCGCGCGCCCGCTCCGTGGCC
AATGATCCCCAGCCGCCCAGCGACCGCGACAGCCCCGACGGCTCCCCCGGCTCCCATCCGCGCCCTGGCCGCTCT
CCCAGGCCGCGCCTCCCTCGAAAGAACTCGGCCCCCGGCCTGACCGACCCCGGCTCCTCGTTGCCTGCCAACGGC
CGCACGCCCCCCTACGCGACCTCCCAGCATGCGAGGCAGCTGAGCCTGCAGCACAGCCTAGCCAAACCCCTGCCG
CAGACGCCCCCTCACCCGGCTGCCGCGAATCAGCCCACCCACCCGGCGGATGCCCTTCATCTCGCCGTCCTCAGC
GACGCCGACCTCAGAGCCGAGCACTCGCCATCCCGACCCACCGACTCCGCCATGGACGGCCGCACAAGCACCATG
GACTCGGCCAGCTCCGCCGCCTCGGCCGCTCCCTTCCCCGGCGGCCCCGACCAGTACGTCCAGGACATGAGCAGC
AGCCTGAGCAGCATCGGCAGCTCCGCCAGGCGCGACAGCAACGCCGACGAGCCGCGCATGCCGCTCTCGGCCAGG
AGCAACGGCACCAACCACTCGGCCGGGCCCTCGCCCGCCGCTACCCAGTCGAGATCGCATGCCGCCGCCGCCTCG
GGCCTCCACGTCGGTGGGCCCTCGCGCGGCTCCTCCGCCCACCTGTCCGGCCTCATGTGCAACGTCCACCGCACC
ACCGGCCGCGAGCCGCCCCCGCTCGTCGGCGCCACCACCACCATCCTGGGCGACAAGCTCTACGTCTTCGGCGGC
CGCGTCCTCTCCCGCAGCCGGCCCGCGCCCCTGACCGCCAACCTCTACGAGCTCGACCTGATCCGCAGACACTGG
AGCAAGCTCGACACCTCGGGCGACCTACCCCCTCCTCGATACTTCCACTCCATGTGCCCGCTCGGCGACACCAAG
ATTGTCTGCTACGGCGGCATGTCTCCCTCGTCGAACCAGCCGACGGGCGCTGACCAGCAGCAACAACAACCGCAA
CCGCAACCGCAACCGCAGCCCGATCAGCCGAAGCAATCGCAGCCCCAGCAGCCCGAAGTCACCGTCATGTCCGAC
ATCTACATATACGACGTCCCCACCAAGAAGTGGACGTACGTGCCGGCCCAGGACGCCCCCCAGGGCCGCTACGCC
CACTGCGCCTGCGTCCTGCCCTCGTCGGCCACCTTCTCGTCCGCCCGTGCGCCGCTGTCCGCGCTGCAGCACAAT
CCCTCGACCGGCAACCCCGGCGAGGGGCAGATCGGCATCAACATCGACGGCTCCGGCGGCGCCGAGATGGTCGTC
GTCGGCGGCCAGGACGGCGGCAATCACTACATCGAGCAGATCAGCGTCTTCAACCTGCGCAGCCTCAAGTGGACC
TCGACGCAGCCGCTCGGCAAGAGCTGCGGCGCCTACCGGAGCGTCACCGCCCCGCTAACCCCCTCCATGGCGAGC
AGGATCGGCAGGGCGAGCCAACAGGCATCGCAGCGTCCGGACGCCGCCGCCGCCGCCGCCGGCGCAGGCCCGGAC
GCGCGCGATCCGGGCTCATCGATGCTCATCTACTCCAACTACAACTTCCTCGACGTCAAGCTCGAGCTGCAGATC
CGCTCCTCGGACGGCTCCCTGACGGAGCGGCCCATGTCGGGCACCTACTCGCCCCCGGGCCTGCGCTTTCCCAAC
GGCGGCGTCATCGACACCCACTTCGTCGTCAGCGGCACCTACCTGACCTCGTCCAAGCAGGAGTACGCGCTCTGG
GCGCTCGATCTGCGCACCCTGACCTGGAGCCGCATCGACGCCGGCGGCAGCGTCTTCAGCCAGGGCAGCTGGAAC
CGCGGCGTGCTGTGGAACCGGCGCAACACGTTCGTCATCCTCGGCAACCGCAAGCGCAGCCTTCGGCTTCTATGA
Transcript >Hirsu2|4481
ATGGCCCACCACCTCACAGGACTGACCGGCTCGCAGAACCCGCCTCGTCGCTCCTCGCGCGCCCGCTCCGTGGCC
AATGATCCCCAGCCGCCCAGCGACCGCGACAGCCCCGACGGCTCCCCCGGCTCCCATCCGCGCCCTGGCCGCTCT
CCCAGGCCGCGCCTCCCTCGAAAGAACTCGGCCCCCGGCCTGACCGACCCCGGCTCCTCGTTGCCTGCCAACGGC
CGCACGCCCCCCTACGCGACCTCCCAGCATGCGAGGCAGCTGAGCCTGCAGCACAGCCTAGCCAAACCCCTGCCG
CAGACGCCCCCTCACCCGGCTGCCGCGAATCAGCCCACCCACCCGGCGGATGCCCTTCATCTCGCCGTCCTCAGC
GACGCCGACCTCAGAGCCGAGCACTCGCCATCCCGACCCACCGACTCCGCCATGGACGGCCGCACAAGCACCATG
GACTCGGCCAGCTCCGCCGCCTCGGCCGCTCCCTTCCCCGGCGGCCCCGACCAGTACGTCCAGGACATGAGCAGC
AGCCTGAGCAGCATCGGCAGCTCCGCCAGGCGCGACAGCAACGCCGACGAGCCGCGCATGCCGCTCTCGGCCAGG
AGCAACGGCACCAACCACTCGGCCGGGCCCTCGCCCGCCGCTACCCAGTCGAGATCGCATGCCGCCGCCGCCTCG
GGCCTCCACGTCGGTGGGCCCTCGCGCGGCTCCTCCGCCCACCTGTCCGGCCTCATGTGCAACGTCCACCGCACC
ACCGGCCGCGAGCCGCCCCCGCTCGTCGGCGCCACCACCACCATCCTGGGCGACAAGCTCTACGTCTTCGGCGGC
CGCGTCCTCTCCCGCAGCCGGCCCGCGCCCCTGACCGCCAACCTCTACGAGCTCGACCTGATCCGCAGACACTGG
AGCAAGCTCGACACCTCGGGCGACCTACCCCCTCCTCGATACTTCCACTCCATGTGCCCGCTCGGCGACACCAAG
ATTGTCTGCTACGGCGGCATGTCTCCCTCGTCGAACCAGCCGACGGGCGCTGACCAGCAGCAACAACAACCGCAA
CCGCAACCGCAACCGCAGCCCGATCAGCCGAAGCAATCGCAGCCCCAGCAGCCCGAAGTCACCGTCATGTCCGAC
ATCTACATATACGACGTCCCCACCAAGAAGTGGACGTACGTGCCGGCCCAGGACGCCCCCCAGGGCCGCTACGCC
CACTGCGCCTGCGTCCTGCCCTCGTCGGCCACCTTCTCGTCCGCCCGTGCGCCGCTGTCCGCGCTGCAGCACAAT
CCCTCGACCGGCAACCCCGGCGAGGGGCAGATCGGCATCAACATCGACGGCTCCGGCGGCGCCGAGATGGTCGTC
GTCGGCGGCCAGGACGGCGGCAATCACTACATCGAGCAGATCAGCGTCTTCAACCTGCGCAGCCTCAAGTGGACC
TCGACGCAGCCGCTCGGCAAGAGCTGCGGCGCCTACCGGAGCGTCACCGCCCCGCTAACCCCCTCCATGGCGAGC
AGGATCGGCAGGGCGAGCCAACAGGCATCGCAGCGTCCGGACGCCGCCGCCGCCGCCGCCGGCGCAGGCCCGGAC
GCGCGCGATCCGGGCTCATCGATGCTCATCTACTCCAACTACAACTTCCTCGACGTCAAGCTCGAGCTGCAGATC
CGCTCCTCGGACGGCTCCCTGACGGAGCGGCCCATGTCGGGCACCTACTCGCCCCCGGGCCTGCGCTTTCCCAAC
GGCGGCGTCATCGACACCCACTTCGTCGTCAGCGGCACCTACCTGACCTCGTCCAAGCAGGAGTACGCGCTCTGG
GCGCTCGATCTGCGCACCCTGACCTGGAGCCGCATCGACGCCGGCGGCAGCGTCTTCAGCCAGGGCAGCTGGAAC
CGCGGCGTGCTGTGGAACCGGCGCAACACGTTCGTCATCCTCGGCAACCGCAAGCGCAGCCTTCGGCTTCTATGA
Gene >Hirsu2|4481
ATGGCCCACCACCTCACAGGACTGACCGGCTCGCAGAACCCGCCTCGTCGCTCCTCGCGCGCCCGCTCCGTGGCC
AATGATCCCCAGCCGCCCAGCGACCGCGACAGCCCCGACGGCTCCCCCGGCTCCCATCCGCGCCCTGGCCGCTCT
CCCAGGCCGCGCCTCCCTCGAAAGAACTCGGCCCCCGGCCTGACCGACCCCGGCTCCTCGTTGCCTGCCAACGGC
CGCACGCCCCCCTACGCGACCTCCCAGCATGCGAGGCAGCTGAGCCTGCAGCACAGCCTAGCCAAACCCCTGCCG
CAGACGCCCCCTCACCCGGCTGCCGCGAATCAGCCCACCCACCCGGCGGATGCCCTTCATCTCGCCGTCCTCAGC
GACGCCGACCTCAGAGCCGAGCACTCGCCATCCCGACCCACCGACTCCGCCATGGACGGCCGCACAAGCACCATG
GACTCGGCCAGCTCCGCCGCCTCGGCCGCTCCCTTCCCCGGCGGCCCCGACCAGTACGTCCAGGACATGAGCAGC
AGCCTGAGCAGCATCGGCAGCTCCGCCAGGCGCGACAGCAACGCCGACGAGCCGCGCATGCCGCTCTCGGCCAGG
AGCAACGGCACCAACCACTCGGCCGGGCCCTCGCCCGCCGCTACCCAGTCGAGATCGCATGCCGCCGCCGCCTCG
GGCCTCCACGTCGGTGGGCCCTCGCGCGGCTCCTCCGCCCACCTGTCCGGCCTCATGTGCAACGTCCACCGCACC
ACCGGCCGCGAGCCGCCCCCGCTCGTCGGCGCCACCACCACCATCCTGGGCGACAAGCTCTACGTCTTCGGCGGC
CGCGTCCTCTCCCGCAGCCGGCCCGCGCCCCTGACCGCCAACCTCTACGAGCTCGACCTGATCCGCAGACACTGG
AGCAAGCTCGACACCTCGGGCGACCTACCCCCTCCTCGATACTTCCACTCCATGTGCCCGCTCGGCGACACCAAG
ATTGTCTGCTACGGCGGCATGTCTCCCTCGTCGAACCAGCCGACGGGCGCTGACCAGCAGCAACAACAACCGCAA
CCGCAACCGCAACCGCAGCCCGATCAGCCGAAGCAATCGCAGCCCCAGCAGCCCGAAGTCACCGTCATGTCCGAC
ATCTACATATACGACGTCCCCACCAAGAAGTGGACGTACGTGCCGGCCCAGGACGCCCCCCAGGGCCGCTACGCC
CACTGCGCCTGCGTCCTGCCCTCGTCGGCCACCTTCTCGTCCGCCCGTGCGCCGCTGTCCGCGCTGCAGCACAAT
CCCTCGACCGGCAACCCCGGCGAGGGGCAGATCGGCATCAACATCGACGGCTCCGGCGGCGCCGAGATGGTCGTC
GTCGGCGGCCAGGACGGCGGCAATCACTACATCGAGCAGATCAGCGTCTTCAACCTGCGCAGCCTCAAGTGGACC
TCGACGCAGCCGCTCGGCAAGAGCTGCGGCGCCTACCGGAGCGTCACCGCCCCGCTAACCCCCTCCATGGCGAGC
AGGATCGGCAGGGCGAGCCAACAGGCATCGCAGCGTCCGGACGCCGCCGCCGCCGCCGCCGGCGCAGGCCCGGAC
GCGCGCGATCCGGGCTCATCGATGCTCATCTACTCCAACTACAACTTCCTCGACGTCAAGCTCGAGCTGCAGATC
CGCTCCTCGGACGGCTCCCTGACGGAGCGGCCCATGTCGGGCACCTACTCGCCCCCGGGCCTGCGCTTTCCCAAC
GGCGGCGTCATCGACACCCACTTCGTCGTCAGCGGCACCTACCTGACCTCGTCCAAGCAGGAGTACGCGCTCTGG
GCGCTCGATCTGCGCACCCTGACCTGGAGCCGCATCGACGCCGGCGGCAGCGTCTTCAGCCAGGGCAGCTGGAAC
CGCGGCGTGCTGTGGAACCGGCGCAACACGTTCGTCATCCTCGGCAACCGCAAGCGCAGTCTCGTCGACGACTAC
AACCACCGGCGCATCAACTTCTCCAACGTCTGCATGGTCGAGCTCGAGGCCTTCGGCTTCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail