Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|447
Gene name
LocationContig_109:16159..18751
Strand+
Gene length (bp)2592
Transcript length (bp)2073
Coding sequence length (bp)2073
Protein length (aa) 691

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00169 PH PH domain 9.2E-07 127 241

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06315|SKG3_YEAST Protein SKG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKG3 PE=1 SV=1 98 480 5.0E-81
sp|A6ZRG7|CA120_YEAS7 CCR4-NOT transcriptional complex subunit CAF120 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF120 PE=3 SV=1 109 482 3.0E-79
sp|P53836|CA120_YEAST CCR4-NOT transcriptional complex subunit CAF120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF120 PE=1 SV=1 109 482 4.0E-79

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|447
MGRNRVLSFMSQFSTGTRTPSPSSSPPNEPSVLRLKHKSDALPTTVQQIDPIRRPVTPPSNPDYGTPLNGSPRNS
STSPSQRPRSTSRPLSIVQAYQPPLMDINEDTIPELQPIFTFLNSHSNKLYQEGYFLKLDDQNTQGKPNSDRTWT
ECFAQLVGTVLSLWDAAELDAAGEDGEVLPKFINLTDASIKMIESLPTRSSDEQPLQNILSISTAGRNRYLLHFN
SHHSLIQWTAGIRLAMYEHSTLQEAYTGALVAGKGKSLNNINVIMERSRFKTEEWVRVRFGAGVPWRRCWCVITP
PDEKEFMKLQKELKKRAPYDRSPVPVLKGDIKFYDSRKDGKKQKKAQPIATITDAYSAYAIYPQAKSLVDASTLL
KIEGNVTVHSDPPSSTEGFIFIMPETHPAVSGFEMMLRFLFPTWDTFGLYGRPGRLVASVLDPRSLMFAMPKHKR
YGYLEPLDVSTLILEDGSAGWTEKDWRKRLKDATGTRMNAIEDGTRSHSRSASRSSARLSGGGGAGGLGRPRVGF
ADNQGSVRSSRSFSLNGGSRMDPAMRDQRDRRPSPMAGAQAHHVRNSSDPDYGPDYGLQRGRQPSGSRGSSDEEV
GNSLRPEMRDFEGMRHMQTPEPVSRPPAFNHGPQARPTSKAYHSPELRRANSRLSSTTLDQMAKAGGISNANNMP
PTAGSADGAFAGASQ*
Coding >Hirsu2|447
ATGGGTCGCAATCGAGTCCTCTCCTTCATGTCCCAGTTTTCCACGGGCACAAGGACACCATCGCCGTCATCGTCG
CCCCCCAACGAGCCCTCGGTCCTCCGCCTCAAGCACAAGTCGGACGCCCTGCCCACGACGGTCCAGCAGATCGAC
CCGATCCGCCGCCCTGTCACGCCCCCGTCCAACCCGGACTATGGCACGCCGCTGAACGGCTCGCCTCGCAACAGC
AGCACCAGCCCCAGCCAGCGCCCGCGCAGCACCTCGCGTCCCCTGTCCATCGTCCAGGCCTACCAGCCGCCCCTC
ATGGATATCAACGAGGACACGATACCCGAGCTGCAGCCCATCTTCACCTTTCTCAACAGCCACTCCAACAAGCTG
TACCAGGAGGGCTATTTCCTCAAGCTCGACGACCAAAACACACAGGGCAAGCCCAACTCCGACAGGACATGGACC
GAGTGCTTTGCCCAACTCGTCGGCACCGTCCTCTCGCTATGGGACGCCGCTGAGCTCGACGCCGCTGGCGAGGAC
GGCGAGGTCCTCCCCAAGTTCATCAACCTCACCGACGCCTCCATCAAGATGATCGAGTCTCTCCCGACGCGCTCG
AGCGACGAGCAACCTTTGCAGAACATACTCAGCATCTCCACTGCCGGCAGGAATCGATATCTCCTGCACTTCAAC
TCGCACCACTCGCTCATCCAGTGGACGGCCGGCATCCGCCTCGCCATGTATGAGCACTCGACGCTCCAGGAAGCC
TACACCGGCGCCCTCGTCGCCGGCAAGGGCAAGTCGCTCAACAACATCAACGTCATCATGGAACGCTCCCGCTTC
AAGACGGAGGAGTGGGTTCGCGTCCGCTTCGGCGCCGGCGTCCCCTGGAGACGCTGCTGGTGCGTCATCACGCCT
CCGGACGAGAAGGAGTTTATGAAGCTGCAAAAGGAGCTCAAGAAGCGCGCCCCCTACGACCGTTCCCCCGTCCCC
GTCCTCAAGGGCGACATCAAGTTTTACGATTCGAGGAAGGATGGCAAGAAGCAGAAGAAGGCCCAGCCCATTGCC
ACCATCACCGACGCCTACTCGGCCTACGCCATCTATCCTCAGGCCAAGTCGTTGGTCGACGCCTCGACGCTCCTC
AAGATCGAGGGCAACGTCACCGTCCACTCCGACCCGCCCTCCTCCACCGAGGGCTTCATCTTCATCATGCCCGAG
ACGCATCCCGCCGTCAGCGGCTTCGAGATGATGCTGCGCTTCCTCTTCCCCACCTGGGACACGTTTGGATTGTAC
GGGCGCCCGGGCCGGCTGGTGGCCAGTGTCCTCGACCCCAGGTCTCTCATGTTCGCCATGCCCAAGCACAAGCGC
TATGGCTACCTCGAGCCCCTCGACGTGTCGACGCTCATCCTCGAGGACGGGAGCGCGGGCTGGACCGAGAAGGAC
TGGCGGAAGCGGTTGAAGGACGCCACCGGCACCCGCATGAACGCCATCGAGGACGGCACCAGGTCACACTCACGC
AGTGCCAGCCGGTCCAGCGCGAGGCTCAGCGGCGGAGGCGGCGCCGGAGGTCTGGGCAGGCCGCGAGTGGGCTTC
GCCGACAACCAGGGCTCCGTCCGCTCCTCGCGATCCTTCTCCCTTAACGGGGGGTCCCGGATGGATCCCGCCATG
CGTGACCAGCGTGACCGCCGGCCCTCACCCATGGCCGGGGCGCAGGCCCATCACGTCCGCAACTCGTCGGACCCC
GACTACGGCCCCGACTACGGCCTGCAGCGTGGACGGCAGCCGTCTGGATCACGCGGCAGCTCGGACGAGGAGGTG
GGCAACTCGCTCCGGCCGGAGATGCGAGACTTTGAGGGCATGCGCCACATGCAGACTCCGGAGCCGGTCTCGCGA
CCCCCCGCCTTTAACCACGGACCACAGGCCCGCCCGACGAGCAAGGCGTACCACTCGCCCGAGCTCCGCCGCGCC
AACAGCCGCCTGTCCAGCACTACGCTGGATCAGATGGCCAAGGCAGGAGGCATCTCCAACGCCAACAACATGCCT
CCAACAGCCGGCAGCGCGGACGGTGCGTTCGCCGGCGCATCGCAATGA
Transcript >Hirsu2|447
ATGGGTCGCAATCGAGTCCTCTCCTTCATGTCCCAGTTTTCCACGGGCACAAGGACACCATCGCCGTCATCGTCG
CCCCCCAACGAGCCCTCGGTCCTCCGCCTCAAGCACAAGTCGGACGCCCTGCCCACGACGGTCCAGCAGATCGAC
CCGATCCGCCGCCCTGTCACGCCCCCGTCCAACCCGGACTATGGCACGCCGCTGAACGGCTCGCCTCGCAACAGC
AGCACCAGCCCCAGCCAGCGCCCGCGCAGCACCTCGCGTCCCCTGTCCATCGTCCAGGCCTACCAGCCGCCCCTC
ATGGATATCAACGAGGACACGATACCCGAGCTGCAGCCCATCTTCACCTTTCTCAACAGCCACTCCAACAAGCTG
TACCAGGAGGGCTATTTCCTCAAGCTCGACGACCAAAACACACAGGGCAAGCCCAACTCCGACAGGACATGGACC
GAGTGCTTTGCCCAACTCGTCGGCACCGTCCTCTCGCTATGGGACGCCGCTGAGCTCGACGCCGCTGGCGAGGAC
GGCGAGGTCCTCCCCAAGTTCATCAACCTCACCGACGCCTCCATCAAGATGATCGAGTCTCTCCCGACGCGCTCG
AGCGACGAGCAACCTTTGCAGAACATACTCAGCATCTCCACTGCCGGCAGGAATCGATATCTCCTGCACTTCAAC
TCGCACCACTCGCTCATCCAGTGGACGGCCGGCATCCGCCTCGCCATGTATGAGCACTCGACGCTCCAGGAAGCC
TACACCGGCGCCCTCGTCGCCGGCAAGGGCAAGTCGCTCAACAACATCAACGTCATCATGGAACGCTCCCGCTTC
AAGACGGAGGAGTGGGTTCGCGTCCGCTTCGGCGCCGGCGTCCCCTGGAGACGCTGCTGGTGCGTCATCACGCCT
CCGGACGAGAAGGAGTTTATGAAGCTGCAAAAGGAGCTCAAGAAGCGCGCCCCCTACGACCGTTCCCCCGTCCCC
GTCCTCAAGGGCGACATCAAGTTTTACGATTCGAGGAAGGATGGCAAGAAGCAGAAGAAGGCCCAGCCCATTGCC
ACCATCACCGACGCCTACTCGGCCTACGCCATCTATCCTCAGGCCAAGTCGTTGGTCGACGCCTCGACGCTCCTC
AAGATCGAGGGCAACGTCACCGTCCACTCCGACCCGCCCTCCTCCACCGAGGGCTTCATCTTCATCATGCCCGAG
ACGCATCCCGCCGTCAGCGGCTTCGAGATGATGCTGCGCTTCCTCTTCCCCACCTGGGACACGTTTGGATTGTAC
GGGCGCCCGGGCCGGCTGGTGGCCAGTGTCCTCGACCCCAGGTCTCTCATGTTCGCCATGCCCAAGCACAAGCGC
TATGGCTACCTCGAGCCCCTCGACGTGTCGACGCTCATCCTCGAGGACGGGAGCGCGGGCTGGACCGAGAAGGAC
TGGCGGAAGCGGTTGAAGGACGCCACCGGCACCCGCATGAACGCCATCGAGGACGGCACCAGGTCACACTCACGC
AGTGCCAGCCGGTCCAGCGCGAGGCTCAGCGGCGGAGGCGGCGCCGGAGGTCTGGGCAGGCCGCGAGTGGGCTTC
GCCGACAACCAGGGCTCCGTCCGCTCCTCGCGATCCTTCTCCCTTAACGGGGGGTCCCGGATGGATCCCGCCATG
CGTGACCAGCGTGACCGCCGGCCCTCACCCATGGCCGGGGCGCAGGCCCATCACGTCCGCAACTCGTCGGACCCC
GACTACGGCCCCGACTACGGCCTGCAGCGTGGACGGCAGCCGTCTGGATCACGCGGCAGCTCGGACGAGGAGGTG
GGCAACTCGCTCCGGCCGGAGATGCGAGACTTTGAGGGCATGCGCCACATGCAGACTCCGGAGCCGGTCTCGCGA
CCCCCCGCCTTTAACCACGGACCACAGGCCCGCCCGACGAGCAAGGCGTACCACTCGCCCGAGCTCCGCCGCGCC
AACAGCCGCCTGTCCAGCACTACGCTGGATCAGATGGCCAAGGCAGGAGGCATCTCCAACGCCAACAACATGCCT
CCAACAGCCGGCAGCGCGGACGGTGCGTTCGCCGGCGCATCGCAATGA
Gene >Hirsu2|447
ATGGGTCGCAATCGAGGTTGGTGCTCCATTCCAGTCCGCGTCTGCCCGTCGTCGGTCGCGCAACACAAGCCCCCC
CCTGCGCCTCTCCGTCGACCACTCACTGCTACCGTCCATATTTGTGCTGCCAACCCGGGGCCCTATGGATCCCTT
GCCCTGCTTATTATTATGACTAGCCGCTGGGATGTGCATCGATCCATCGTCCTGCACACGCCCTAATGAGCCACT
GATGCCCACTGCCCCCTCCTTTTCTGCCTGCGCCGCCTACTAATAATTTGCGGCCAACGCCTCGCCTGTCTCTTC
CTAGTCCTCTCCTTCATGTCCCAGTTTTCCACGGGCACAAGGACACCATCGCCGTCATCGTCGCCCCCCAACGAG
CCCTCGGTCCTCCGCCTCAAGCACAAGTCGGACGCCCTGCCCACGACGGTCCAGCAGATCGACCCGATCCGCCGC
CCTGTCACGCCCCCGTCCAACCCGGACTATGGCACGCCGCTGAACGGCTCGCCTCGCAACAGCAGCACCAGCCCC
AGCCAGCGCCCGCGCAGCACCTCGCGTCCCCTGTCCATCGTCCAGGCCTACCAGCCGCCCCTCATGGATATCAAC
GAGGACACGATACCCGAGCTGCAGCCCATCTTCACCTTTCTCAACAGCCACTCCAACAAGCTGTACCAGGAGGGC
TATTTCCTCAAGCTCGACGACCAAAACACACGTACGTCGTCTTCCCCCCTTCGCCTGCCCGTCTCCCCGCGCGTC
CGTGTCGCGTTCGCCGTCTGCCACCGCTCGCCCGCTGACTTTTCTCGACCGTCTGCAGAGGGCAAGCCCAACTCC
GACAGGACATGGACCGAGTGCTTTGCCCAACTCGTCGGCACCGTCCTCTCGCTATGGGACGCCGCTGAGCTCGAC
GCCGCTGGCGAGGACGGCGAGGTCCTCCCCAAGTTCATCAACCTCACCGACGCCTCCATCAAGATGGTATGTCCC
CCGGCTGCGCACTGCACCCGCCTCTCACTCCCCCCTGCTCGTCGCTGACTCCGCCGCCGCAGATCGAGTCTCTCC
CGACGCGCTCGAGCGACGAGCAACCTTTGCAGAACATACTCAGCATCTCCACTGCCGGCAGGAATCGATATCTCC
TGCACTTCAACTCGCACCACTCGCTCATCCAGTGGACGGCCGGCATCCGCCTCGCCATGTATGAGCACTCGACGC
TCCAGGAAGCCTACACCGGCGCCCTCGTCGCCGGCAAGGGCAAGTCGCTCAACAACATCAACGTCATCATGGAAC
GCTCCCGCTTCAAGACGGAGGAGTGGGTTCGCGTCCGCTTCGGCGCCGGCGTCCCCTGGAGACGCTGCTGGTGCG
TCATCACGCCTCCGGACGAGAAGGAGTTTATGAAGCTGCAAAAGGAGCTCAAGAAGCGCGCCCCCTACGACCGTT
CCCCCGTCCCCGTCCTCAAGGGCGACATCAAGTTTTACGATTCGAGGAAGGATGGCAAGAAGCAGAAGAAGGCCC
AGCCCATTGCCACCATCACCGACGCCTACTCGGCCTACGCCATCTATCCTCAGGCCAAGTCGTTGGTCGACGCCT
CGACGCTCCTCAAGATCGAGGGCAACGTCACCGTCCACTCCGACCCGCCCTCCTCCACCGAGGGCTTCATCTTCA
TCATGCCCGAGACGCATCCCGCCGTCAGCGGCTTCGAGATGATGCTGCGCTTCCTCTTCCCCACCTGGGACACGT
TTGGATTGTACGGGCGCCCGGGCCGGCTGGTGGCCAGTGTCCTCGACCCCAGGTCTCTCATGTTCGCCATGCCCA
AGCACAAGCGCTATGGCTACCTCGAGCCCCTCGACGTGTCGACGCTCATCCTCGAGGACGGGAGCGCGGGCTGGA
CCGAGAAGGACTGGCGGAAGCGGTTGAAGGACGCCACCGGCACCCGCATGAACGCCATCGAGGACGGCACCAGGT
CACACTCACGCAGTGCCAGCCGGTCCAGCGCGAGGCTCAGCGGCGGAGGCGGCGCCGGAGGTCTGGGCAGGCCGC
GAGTGGGCTTCGCCGACAACCAGGGCTCCGTCCGCTCCTCGCGATCCTTCTCCCTTAACGGGGGGTCCCGGATGG
ATCCCGCCATGCGTGACCAGCGTGACCGCCGGCCCTCACCCATGGCCGGGGCGCAGGCCCATCACGTCCGCAACT
CGTCGGACCCCGACTACGGCCCCGACTACGGCCTGCAGCGTGGACGGCAGCCGTCTGGATCACGCGGCAGCTCGG
ACGAGGAGGTGGGCAACTCGCTCCGGCCGGAGATGCGAGACTTTGAGGGCATGCGCCACATGCAGACTCCGGAGC
CGGTCTCGCGACCCCCCGCCTTTAACCACGGACCACAGGCCCGCCCGACGAGCAAGGCGTACCACTCGCCCGAGC
TCCGCCGCGCCAACAGCCGCCTGTCCAGCACTACGCTGGATCAGATGGCCAAGGCAGGAGGCATCTCCAACGCCA
ACAACATGCCTCCAACAGCCGGCAGCGCGGACGGTGCGTTCGCCGGCGCATCGGTACATCCACACGCCAACCCCC
AAGGGACTTTTGCTAACGACTACGCCTCGCGTGAAGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail