Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4466
Gene name
LocationContig_2271:2192..2635
Strand-
Gene length (bp)443
Transcript length (bp)318
Coding sequence length (bp)318
Protein length (aa) 106

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03226 Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly 1.7E-16 15 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9W2X7|YPL1_DROME Protein yippee-like CG15309 OS=Drosophila melanogaster GN=CG15309 PE=3 SV=1 1 97 6.0E-29
sp|O60688|YPEL1_HUMAN Protein yippee-like 1 OS=Homo sapiens GN=YPEL1 PE=3 SV=1 5 97 2.0E-28
sp|Q2YDI3|YPEL2_BOVIN Protein yippee-like 2 OS=Bos taurus GN=YPEL2 PE=3 SV=1 5 97 2.0E-28
sp|Q65Z58|YPEL2_CHLAE Protein yippee-like 2 OS=Chlorocebus aethiops GN=YPEL2 PE=3 SV=1 5 97 2.0E-28
sp|Q96QA6|YPEL2_HUMAN Protein yippee-like 2 OS=Homo sapiens GN=YPEL2 PE=1 SV=1 5 97 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9W2X7|YPL1_DROME Protein yippee-like CG15309 OS=Drosophila melanogaster GN=CG15309 PE=3 SV=1 1 97 6.0E-29
sp|O60688|YPEL1_HUMAN Protein yippee-like 1 OS=Homo sapiens GN=YPEL1 PE=3 SV=1 5 97 2.0E-28
sp|Q2YDI3|YPEL2_BOVIN Protein yippee-like 2 OS=Bos taurus GN=YPEL2 PE=3 SV=1 5 97 2.0E-28
sp|Q65Z58|YPEL2_CHLAE Protein yippee-like 2 OS=Chlorocebus aethiops GN=YPEL2 PE=3 SV=1 5 97 2.0E-28
sp|Q96QA6|YPEL2_HUMAN Protein yippee-like 2 OS=Homo sapiens GN=YPEL2 PE=1 SV=1 5 97 2.0E-28
sp|Q65Z95|YPEL2_MOUSE Protein yippee-like 2 OS=Mus musculus GN=Ypel2 PE=2 SV=1 5 97 2.0E-28
sp|Q5RDN9|YPEL2_PONAB Protein yippee-like 2 OS=Pongo abelii GN=YPEL2 PE=3 SV=1 5 97 2.0E-28
sp|Q65Z59|YPEL1_CHLAE Protein yippee-like 1 OS=Chlorocebus aethiops GN=YPEL1 PE=3 SV=1 5 97 2.0E-28
sp|Q9DG42|YPEL1_COTJA Protein yippee-like 1 OS=Coturnix coturnix japonica GN=YPEL1 PE=3 SV=1 5 97 2.0E-28
sp|Q6NWI4|YPEL3_DANRE Protein yippee-like 3 OS=Danio rerio GN=ypel3 PE=3 SV=1 5 97 3.0E-28
sp|Q9SR97|YIPL1_ARATH Protein yippee-like At3g08990 OS=Arabidopsis thaliana GN=At3g08990 PE=2 SV=2 14 97 3.0E-28
sp|P61237|YPEL3_MOUSE Protein yippee-like 3 OS=Mus musculus GN=Ypel3 PE=1 SV=1 5 97 3.0E-28
sp|P61236|YPEL3_HUMAN Protein yippee-like 3 OS=Homo sapiens GN=YPEL3 PE=2 SV=1 5 97 3.0E-28
sp|Q65Z57|YPEL3_CHLAE Protein yippee-like 3 OS=Chlorocebus aethiops GN=YPEL3 PE=3 SV=1 5 97 3.0E-28
sp|A6QPH8|YPEL3_BOVIN Protein yippee-like 3 OS=Bos taurus GN=YPEL3 PE=3 SV=2 5 97 3.0E-28
sp|Q9ESC7|YPEL1_MOUSE Protein yippee-like 1 OS=Mus musculus GN=Ypel1 PE=2 SV=1 5 97 3.0E-28
sp|Q5XID5|YPEL4_RAT Protein yippee-like 4 OS=Rattus norvegicus GN=Ypel4 PE=1 SV=1 5 97 4.0E-28
sp|Q65Z93|YPEL4_MOUSE Protein yippee-like 4 OS=Mus musculus GN=Ypel4 PE=2 SV=1 5 97 4.0E-28
sp|Q65Z56|YPEL4_CHLAE Protein yippee-like 4 OS=Chlorocebus aethiops GN=YPEL4 PE=2 SV=1 5 97 5.0E-28
sp|Q96NS1|YPEL4_HUMAN Protein yippee-like 4 OS=Homo sapiens GN=YPEL4 PE=2 SV=1 5 97 5.0E-28
sp|Q65Z54|YPEL3_ORYLA Protein yippee-like 3 OS=Oryzias latipes GN=ypel3 PE=3 SV=1 5 97 1.0E-27
sp|P59234|YIPL_SOLTU Protein yippee-like OS=Solanum tuberosum PE=2 SV=1 12 97 3.0E-27
sp|Q9LY56|YIPL4_ARATH Protein yippee-like At3g55890 OS=Arabidopsis thaliana GN=At3g55890 PE=2 SV=1 1 97 4.0E-27
sp|Q9T096|YIPL6_ARATH Protein yippee-like At4g27745 OS=Arabidopsis thaliana GN=At4g27745 PE=3 SV=2 13 97 7.0E-26
sp|Q9U3G6|YPL1_CAEEL Protein yippee-like F37A8.5 OS=Caenorhabditis elegans GN=F37A8.5 PE=3 SV=1 5 97 2.0E-25
sp|Q9C777|YIPL3_ARATH Protein yippee-like At3g11230 OS=Arabidopsis thaliana GN=At3g11230 PE=2 SV=1 13 97 2.0E-25
sp|Q9FN32|YIPL7_ARATH Protein yippee-like At5g53940 OS=Arabidopsis thaliana GN=At5g53940 PE=2 SV=1 1 97 7.0E-25
sp|Q9XZF0|YIPP_DROME Protein yippee OS=Drosophila melanogaster GN=Yippee PE=1 SV=1 1 101 1.0E-24
sp|Q8S5M8|YIPL_ORYSJ Putative yippee-like protein Os10g0369500 OS=Oryza sativa subsp. japonica GN=Os10g0369500 PE=3 SV=1 10 97 4.0E-24
sp|Q5RDU7|YPEL5_PONAB Protein yippee-like 5 OS=Pongo abelii GN=YPEL5 PE=2 SV=1 1 101 1.0E-23
sp|Q3ZBE7|YPEL5_BOVIN Protein yippee-like 5 OS=Bos taurus GN=YPEL5 PE=2 SV=1 1 101 1.0E-23
sp|Q65Z55|YPEL5_CHLAE Protein yippee-like 5 OS=Chlorocebus aethiops GN=YPEL5 PE=2 SV=1 1 101 1.0E-23
sp|P62699|YPEL5_HUMAN Protein yippee-like 5 OS=Homo sapiens GN=YPEL5 PE=1 SV=1 1 101 1.0E-23
sp|P62700|YPEL5_MOUSE Protein yippee-like 5 OS=Mus musculus GN=Ypel5 PE=1 SV=1 1 101 1.0E-23
sp|P38191|MOH1_YEAST Protein yippee-like MOH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOH1 PE=3 SV=1 15 102 2.0E-23
sp|Q4R4Q6|YPEL5_MACFA Protein yippee-like 5 OS=Macaca fascicularis GN=YPEL5 PE=2 SV=1 1 101 6.0E-23
sp|Q9URW3|YIPL_SCHPO Protein yippee-like PJ691.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPJ691.02 PE=3 SV=1 1 99 3.0E-19
sp|Q2V3E2|YIPL5_ARATH Protein yippee-like At4g27740 OS=Arabidopsis thaliana GN=At4g27740 PE=3 SV=1 9 97 6.0E-19
sp|O44440|YPL2_CAEEL Protein yippee-like B0546.4 OS=Caenorhabditis elegans GN=B0546.4 PE=3 SV=1 14 97 1.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4466
MGLAYNTYLSSNKIYGCKSCKTHLANHEDIISRHGKAYLFHNVVNIDAGEPNERNMTTGRHVVRDILCRQCKETV
GWKYDKAYENSEKYKEGKFILEAELLCNVA*
Coding >Hirsu2|4466
ATGGGACTAGCATACAACACATATCTCAGCAGCAACAAAATTTATGGCTGCAAATCATGCAAGACGCATCTCGCA
AACCATGAGGACATCATCAGCAGGCACGGAAAGGCATATCTCTTCCACAACGTTGTGAACATCGACGCTGGTGAG
CCCAACGAGCGAAACATGACAACTGGCCGTCACGTTGTTCGCGACATCCTATGCCGTCAGTGCAAGGAGACCGTT
GGCTGGAAGTACGATAAGGCCTACGAAAACTCAGAGAAGTACAAGGAAGGCAAATTTATACTTGAGGCCGAACTC
CTTTGCAATGTCGCATGA
Transcript >Hirsu2|4466
ATGGGACTAGCATACAACACATATCTCAGCAGCAACAAAATTTATGGCTGCAAATCATGCAAGACGCATCTCGCA
AACCATGAGGACATCATCAGCAGGCACGGAAAGGCATATCTCTTCCACAACGTTGTGAACATCGACGCTGGTGAG
CCCAACGAGCGAAACATGACAACTGGCCGTCACGTTGTTCGCGACATCCTATGCCGTCAGTGCAAGGAGACCGTT
GGCTGGAAGTACGATAAGGCCTACGAAAACTCAGAGAAGTACAAGGAAGGCAAATTTATACTTGAGGCCGAACTC
CTTTGCAATGTCGCATGA
Gene >Hirsu2|4466
ATGGGACTAGCATACAACACATATCTCAGCAGCAACAAAATTTATGGCTGCAAATCATGCAAGACGCATCTCGCA
AACCATGAGGACATCATCAGCAGGGTGCGCCGTGCGCTGCCTCTCTTCCTTCTCTTGCAACCCTCCATATTCCAC
ATGTGATCTATAAGCGTGGTCCCACCTCTTTCTGGCGGCTCGCTGATGCTTCAGGATAGAACTTTCGCGGTCAGC
ACGGAAAGGCATATCTCTTCCACAACGTTGTGAACATCGACGCTGGTGAGCCCAACGAGCGAAACATGACAACTG
GCCGTCACGTTGTTCGCGACATCCTATGCCGTCAGTGCAAGGAGACCGTTGGCTGGAAGTACGATAAGGCCTACG
AAAACTCAGAGAAGTACAAGGAAGGCAAATTTATACTTGAGGCCGAACTCCTTTGCAATGTCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail