Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4440
Gene name
LocationContig_2260:157..549
Strand-
Gene length (bp)392
Transcript length (bp)330
Coding sequence length (bp)330
Protein length (aa) 110

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06863 DUF1254 Protein of unknown function (DUF1254) 2.3E-09 38 99

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4087 0.2939 0.4463 0.1148 0.258 0.0525 0.2527 0.2471 0.1747 0.0692

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup320
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|513
Ophiocordyceps australis map64 (Brazil) OphauB2|5354
Ophiocordyceps camponoti-floridani Ophcf2|00923
Ophiocordyceps camponoti-rufipedis Ophun1|512
Ophiocordyceps kimflemingae Ophio5|4563
Ophiocordyceps kimflemingae Ophio5|7261
Ophiocordyceps subramaniannii Hirsu2|252
Ophiocordyceps subramaniannii Hirsu2|4440 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6269
Ophiocordyceps subramaniannii Hirsu2|6270

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4440
LSLGAERAANATAFAITYGYPLTQYAYTLGPVLASVGTNAIRHERDVRTAESDHEPVARANADTLSSTVAVDLSL
NDVVLTIPKRKDNLYFVVSFFDLYVGRACREGKR*
Coding >Hirsu2|4440
CTGAGCTTGGGCGCCGAGCGCGCCGCCAACGCGACCGCGTTCGCCATCACGTACGGCTACCCCCTGACGCAGTAC
GCCTACACGCTGGGCCCGGTCCTGGCCTCGGTCGGGACGAACGCGATCCGGCACGAGCGCGACGTCCGCACGGCC
GAGTCGGACCACGAGCCCGTGGCCCGCGCCAACGCCGACACGCTGTCGTCGACGGTCGCCGTCGACCTGTCGCTC
AACGACGTCGTGCTGACGATCCCCAAGCGCAAGGACAACCTCTACTTCGTCGTCTCCTTCTTTGACCTGTACGTG
GGCCGCGCGTGTCGTGAAGGAAAGCGTTGA
Transcript >Hirsu2|4440
CTGAGCTTGGGCGCCGAGCGCGCCGCCAACGCGACCGCGTTCGCCATCACGTACGGCTACCCCCTGACGCAGTAC
GCCTACACGCTGGGCCCGGTCCTGGCCTCGGTCGGGACGAACGCGATCCGGCACGAGCGCGACGTCCGCACGGCC
GAGTCGGACCACGAGCCCGTGGCCCGCGCCAACGCCGACACGCTGTCGTCGACGGTCGCCGTCGACCTGTCGCTC
AACGACGTCGTGCTGACGATCCCCAAGCGCAAGGACAACCTCTACTTCGTCGTCTCCTTCTTTGACCTGTACGTG
GGCCGCGCGTGTCGTGAAGGAAAGCGTTGA
Gene >Hirsu2|4440
CTGAGCTTGGGCGCCGAGCGCGCCGCCAACGCGACCGCGTTCGCCATCACGGTGAGGCGCCCGTATCCGAGAGGC
CGCGGCCCCTGGCCATCGGGCGCTGACGATGCCTTTAGTACGGCTACCCCCTGACGCAGTACGCCTACACGCTGG
GCCCGGTCCTGGCCTCGGTCGGGACGAACGCGATCCGGCACGAGCGCGACGTCCGCACGGCCGAGTCGGACCACG
AGCCCGTGGCCCGCGCCAACGCCGACACGCTGTCGTCGACGGTCGCCGTCGACCTGTCGCTCAACGACGTCGTGC
TGACGATCCCCAAGCGCAAGGACAACCTCTACTTCGTCGTCTCCTTCTTTGACCTGTACGTGGGCCGCGCGTGTC
GTGAAGGAAAGCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail