Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4439
Gene name
LocationContig_226:27505..28813
Strand-
Gene length (bp)1308
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.4E-14 21 242

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 20 253 2.0E-08
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 20 244 4.0E-08
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 20 253 7.0E-08

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 377 394 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4439
MLALERRELIQILYEELPDKSKVLLGRAVAGIRQSENGVEVELADGTSQRGDLVIGADGVHSIVREAMWQHADAA
EPGLITDDERNIMMRNWVCLFGLGPGEPGLRNELSVTSYPGKRAAMTITQPRLTTFLFFWKAETATALSRPESAA
RFTAQDADRAAAGVAHLPVNETMVFGDFWNKRTRAQLSHIEEGVLTRWHYGRLVLAGDAVHKVTPNTAYGGNLAI
EGVAVLANQLHRAVVEQRRRREGSGRCDGDGDQEEKDEATPSWGAASLAQADLEAAFRAYQARHESRAREVCATA
HWVTRLQTWDTPWLKFWSLYVMPLSDRKALARIIGALVRRAPLLDFVPLDRGPEGKVRWEHGETRSDDGYGKPWR
GALAALAAVGLVASFAFFIRRWPLSGYTAREALSSDL*
Coding >Hirsu2|4439
ATGCTGGCGCTCGAGCGGCGGGAGCTCATCCAGATCCTCTACGAGGAACTGCCCGACAAGTCCAAGGTGCTCCTG
GGCCGAGCCGTCGCCGGCATCCGCCAGAGCGAGAACGGCGTCGAGGTCGAGCTGGCGGACGGCACGTCGCAGCGG
GGCGACTTGGTCATCGGCGCCGACGGCGTCCACAGCATCGTCCGCGAAGCCATGTGGCAGCACGCCGACGCCGCC
GAGCCGGGCCTCATCACCGACGACGAGCGGAACATCATGATGAGGAACTGGGTCTGTCTGTTCGGCCTCGGCCCC
GGTGAGCCCGGCCTGCGCAACGAGCTCAGCGTGACGTCGTACCCGGGCAAACGCGCCGCCATGACCATCACCCAG
CCCCGGCTCACCACCTTCCTCTTCTTCTGGAAGGCCGAGACGGCGACAGCGCTGTCGCGGCCCGAGAGCGCCGCG
CGCTTCACGGCGCAGGACGCGGACCGCGCCGCCGCCGGCGTCGCCCACCTGCCCGTCAACGAGACCATGGTCTTC
GGCGACTTCTGGAACAAGCGGACCCGGGCGCAGCTGTCGCACATCGAGGAGGGCGTCCTGACGCGCTGGCACTAC
GGCCGCCTCGTCCTCGCCGGCGACGCCGTCCACAAGGTCACGCCCAACACCGCCTACGGCGGCAACCTGGCCATC
GAGGGCGTCGCCGTCCTGGCCAACCAGCTGCACAGGGCCGTTGTCGAGCAGCGGCGCCGACGAGAGGGTTCAGGC
CGGTGTGATGGAGACGGGGACCAAGAGGAAAAGGACGAGGCGACGCCGTCTTGGGGCGCCGCATCGCTCGCGCAG
GCCGACCTCGAAGCGGCGTTCCGCGCCTACCAGGCACGGCACGAGTCGCGGGCGCGCGAGGTCTGCGCCACCGCC
CACTGGGTCACCCGGCTGCAGACGTGGGACACGCCCTGGCTCAAGTTCTGGTCGCTGTACGTCATGCCGCTGTCG
GACCGCAAGGCGCTGGCCCGCATCATCGGCGCCCTCGTCCGCCGCGCGCCGCTGCTCGACTTCGTGCCCCTGGAC
CGCGGGCCCGAGGGCAAGGTGCGGTGGGAGCACGGCGAGACGAGAAGCGACGACGGCTACGGCAAGCCGTGGCGC
GGCGCCCTGGCCGCGCTCGCTGCCGTCGGCTTGGTTGCTTCGTTTGCTTTCTTCATCCGGCGGTGGCCGTTGTCG
GGTTATACCGCTCGCGAGGCGCTGTCGTCGGATCTCTAG
Transcript >Hirsu2|4439
ATGCTGGCGCTCGAGCGGCGGGAGCTCATCCAGATCCTCTACGAGGAACTGCCCGACAAGTCCAAGGTGCTCCTG
GGCCGAGCCGTCGCCGGCATCCGCCAGAGCGAGAACGGCGTCGAGGTCGAGCTGGCGGACGGCACGTCGCAGCGG
GGCGACTTGGTCATCGGCGCCGACGGCGTCCACAGCATCGTCCGCGAAGCCATGTGGCAGCACGCCGACGCCGCC
GAGCCGGGCCTCATCACCGACGACGAGCGGAACATCATGATGAGGAACTGGGTCTGTCTGTTCGGCCTCGGCCCC
GGTGAGCCCGGCCTGCGCAACGAGCTCAGCGTGACGTCGTACCCGGGCAAACGCGCCGCCATGACCATCACCCAG
CCCCGGCTCACCACCTTCCTCTTCTTCTGGAAGGCCGAGACGGCGACAGCGCTGTCGCGGCCCGAGAGCGCCGCG
CGCTTCACGGCGCAGGACGCGGACCGCGCCGCCGCCGGCGTCGCCCACCTGCCCGTCAACGAGACCATGGTCTTC
GGCGACTTCTGGAACAAGCGGACCCGGGCGCAGCTGTCGCACATCGAGGAGGGCGTCCTGACGCGCTGGCACTAC
GGCCGCCTCGTCCTCGCCGGCGACGCCGTCCACAAGGTCACGCCCAACACCGCCTACGGCGGCAACCTGGCCATC
GAGGGCGTCGCCGTCCTGGCCAACCAGCTGCACAGGGCCGTTGTCGAGCAGCGGCGCCGACGAGAGGGTTCAGGC
CGGTGTGATGGAGACGGGGACCAAGAGGAAAAGGACGAGGCGACGCCGTCTTGGGGCGCCGCATCGCTCGCGCAG
GCCGACCTCGAAGCGGCGTTCCGCGCCTACCAGGCACGGCACGAGTCGCGGGCGCGCGAGGTCTGCGCCACCGCC
CACTGGGTCACCCGGCTGCAGACGTGGGACACGCCCTGGCTCAAGTTCTGGTCGCTGTACGTCATGCCGCTGTCG
GACCGCAAGGCGCTGGCCCGCATCATCGGCGCCCTCGTCCGCCGCGCGCCGCTGCTCGACTTCGTGCCCCTGGAC
CGCGGGCCCGAGGGCAAGGTGCGGTGGGAGCACGGCGAGACGAGAAGCGACGACGGCTACGGCAAGCCGTGGCGC
GGCGCCCTGGCCGCGCTCGCTGCCGTCGGCTTGGTTGCTTCGTTTGCTTTCTTCATCCGGCGGTGGCCGTTGTCG
GGTTATACCGCTCGCGAGGCGCTGTCGTCGGATCTCTAG
Gene >Hirsu2|4439
ATGCTGGCGCTCGAGCGGCGGGAGCTCATCCAGATCCTCTACGAGGAACTGCCCGACAAGTCCAAGGTGCTCCTG
GGCCGAGCCGTCGCCGGCATCCGCCAGAGCGAGAACGGCGTCGAGGTCGAGCTGGCGGACGGCACGTCGCAGCGG
GGCGACTTGGTCATCGGCGCCGACGGCGTCCACAGCATCGTCCGCGAAGCCATGTGGCAGCACGCCGACGCCGCC
GAGCCGGGCCTCATCACCGACGACGAGCGGAACAGTGAGCTCGCAGCCTCCCTGTTCCTCTCTCGATCTCGGTGA
GAAGGCAACGGGCTAACGCACGGGTCAGTCATGATGAGGAACTGGGTCTGTCTGTTCGGCCTCGGCCCCGGTGAG
CCCGGCCTGCGCAACGAGCTCAGCGTGACGTCGTACCCGGGCAAACGCGCCGCCATGACCATCACCCAGCCCCGG
CTCACCACCTTCCTCTTCTTCTGGAAGGCCGAGACGGCGACAGCGCTGTCGCGGCCCGAGAGCGCCGCGCGCTTC
ACGGCGCAGGACGCGGACCGCGCCGCCGCCGGCGTCGCCCACCTGCCCGTCAACGAGACCATGGTCTTCGGCGAC
TTCTGGAACAAGCGGACCCGGGCGCAGCTGTCGCACATCGAGGAGGGCGTCCTGACGCGCTGGCACTACGGCCGC
CTCGTCCTCGCCGGCGACGCCGTCCACAAGGTCACGCCCAACACCGCCTACGGCGGCAACCTGGCCATCGAGGGC
GTCGCCGTCCTGGCCAACCAGCTGCACAGGGCCGTTGTCGAGCAGCGGCGCCGACGAGAGGGTTCAGGCCGGTGT
GATGGAGACGGGGACCAAGAGGAAAAGGACGAGGCGACGCCGTCTTGGGGCGCCGCATCGCTCGCGCAGGCCGAC
CTCGAAGCGGCGTTCCGCGCCTACCAGGCACGGCACGAGTCGCGGGCGCGCGAGGTCTGCGCCACCGCCCACTGG
GTCACCCGGCTGCAGACGTGGGACACGCCCTGGCTCAAGTTCTGGTCGCTGTACGTCATGCCGCTGTCGGACCGC
AAGGCGCTGGCCCGCATCATCGGCGCCCTCGTCCGCCGCGCGCCGCTGCTCGACTTCGTGCCCCTGGACCGCGGG
CCCGAGGGCAAGGTGCGGTGGGAGCACGGCGAGACGAGAAGCGACGACGGCTACGGCAAGCCGTGGCGCGGCGCC
CTGGCCGCGCTCGCTGCCGTCGGCTTGGTTGCTTCGTTTGCTTTCTTCATCCGGCGGTGGCCGTTGTCGGGTTAT
ACCGCTCGCGAGGCGCTGTCGTCGGATCTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail