Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4437
Gene name
LocationContig_226:23083..25111
Strand-
Gene length (bp)2028
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.1E-13 55 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 56 465 2.0E-22
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 56 465 2.0E-20
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 35 473 2.0E-19
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 14 531 1.0E-18
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 45 351 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 56 465 2.0E-22
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 56 465 2.0E-20
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 35 473 2.0E-19
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 14 531 1.0E-18
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 45 351 5.0E-16
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 45 538 9.0E-13
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 45 538 9.0E-13
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 57 489 3.0E-11
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 63 282 8.0E-11
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 71 478 3.0E-10
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 63 357 2.0E-09
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 59 537 2.0E-09
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 63 208 1.0E-08
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 58 534 2.0E-06
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 20 371 5.0E-06
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 20 371 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 114 136 22
3 178 200 22
4 202 224 22
5 244 266 22
6 273 295 22
7 315 337 22
8 350 367 17
9 377 399 22
10 406 428 22
11 443 465 22
12 520 537 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4437
MPPRLADTSLGVFEEIDLGPRTPPSGLGTGAAFPNVRLDKLTGFKSVLLEMIIYATLFMLALDNSIVAILQPSIA
YQFRALDKFPWLAVGHQLGGLTAAMPLAKLYSVFDAKPLFLLFTVAFLGASALSGTAVNMASEIVGRVWAGIAVT
GMRCGLLLIHKRNLVEKERHAACPDPLTIVWALGSLLGPVVGGALALASWRWAFYMNLFPILIILPVCILIVPSR
PSVRQGSTSRHLEALDPMGILLSVVSMTTFAAATNLAGVLFSWKGSNVIILYAVSAICCVGFALQQTFCIFTTAS
NQLVPIPLLGSREAMINYFFVSCGSTMAYITTNYVPIYLELIRGASPAQTAGRTLPLGFLLAISFLFSENLRHTA
VFYRTWSVFAAALGLAGAVLMSKVNVDTPTATISGYQTILGIGAGCFAHAGFVSVQTSLYPGHDTSDAALMLVAQ
LGGSTIGLSLAGAIFVNTAKKSLASLFPELGADALDLVMAGASGDFLSNLRAKDQALALDCIVEALRKVFIHAYA
ASAVAIFMGALIEAE*
Coding >Hirsu2|4437
ATGCCTCCTCGGCTAGCCGACACGTCGCTTGGCGTCTTCGAAGAGATCGACCTTGGGCCTCGCACCCCCCCTTCC
GGCCTCGGCACCGGGGCAGCTTTCCCCAACGTCCGGCTCGACAAGCTCACCGGCTTCAAGAGTGTGCTGCTTGAG
ATGATCATCTACGCAACCTTGTTCATGCTGGCCCTCGACAACTCCATCGTCGCCATCCTGCAGCCGTCCATCGCG
TACCAGTTCCGGGCCCTCGACAAATTTCCATGGCTCGCTGTTGGACACCAGCTCGGCGGGTTGACCGCGGCTATG
CCGCTGGCAAAACTCTACTCCGTCTTCGATGCTAAGCCGCTCTTCCTCCTCTTCACTGTCGCGTTCTTGGGGGCC
TCGGCGCTGAGCGGCACGGCTGTGAACATGGCGTCTGAGATTGTCGGCCGCGTCTGGGCCGGCATCGCTGTCACG
GGCATGCGTTGCGGCCTTCTGCTCATCCACAAACGCAACCTGGTGGAGAAGGAACGACATGCGGCATGCCCCGAT
CCGTTGACTATCGTCTGGGCCCTGGGATCTCTCCTCGGTCCCGTCGTGGGCGGCGCGCTCGCGCTGGCCTCGTGG
CGCTGGGCCTTCTACATGAACCTCTTCCCCATTCTGATCATCCTGCCCGTGTGCATCCTCATCGTGCCATCCCGC
CCGTCGGTCCGCCAAGGCTCAACAAGCCGTCACCTCGAAGCTTTGGATCCCATGGGGATACTCCTCAGCGTCGTC
TCCATGACCACATTCGCCGCCGCGACCAACCTCGCCGGGGTGCTGTTCAGCTGGAAAGGCTCCAACGTCATCATT
CTCTACGCCGTGAGCGCCATCTGCTGCGTCGGCTTTGCCCTTCAGCAAACCTTTTGCATCTTCACCACGGCCTCG
AATCAGCTGGTCCCCATTCCGCTCCTGGGCAGCCGGGAGGCTATGATCAACTACTTCTTTGTGTCGTGCGGCAGC
ACCATGGCATATATCACGACAAACTACGTGCCCATCTACTTGGAACTGATTAGGGGCGCGTCGCCTGCCCAGACG
GCGGGGCGGACGCTGCCTCTCGGCTTCCTGCTCGCCATCAGCTTCCTCTTCAGCGAGAATCTTCGACATACCGCT
GTTTTCTACCGAACTTGGAGTGTTTTCGCCGCCGCCCTGGGCCTGGCTGGGGCTGTTCTCATGAGCAAGGTCAAC
GTCGACACGCCGACCGCGACCATCAGCGGCTACCAGACCATACTCGGAATCGGCGCAGGATGCTTCGCCCATGCC
GGCTTCGTCTCCGTCCAAACCAGCCTCTACCCGGGACACGACACTTCCGACGCCGCTCTCATGCTGGTGGCTCAG
CTAGGCGGGTCGACCATCGGCCTCTCCCTGGCCGGGGCCATCTTCGTCAACACCGCCAAGAAGAGCCTGGCGAGC
CTGTTCCCGGAACTCGGCGCCGACGCCCTCGATCTGGTCATGGCGGGCGCCAGTGGGGACTTTCTGTCTAATCTG
AGGGCGAAAGACCAGGCGTTGGCGCTCGACTGCATTGTCGAGGCGCTTCGGAAGGTCTTCATTCACGCCTACGCC
GCCTCTGCCGTGGCCATCTTCATGGGCGCCCTGATCGAGGCGGAATAG
Transcript >Hirsu2|4437
ATGCCTCCTCGGCTAGCCGACACGTCGCTTGGCGTCTTCGAAGAGATCGACCTTGGGCCTCGCACCCCCCCTTCC
GGCCTCGGCACCGGGGCAGCTTTCCCCAACGTCCGGCTCGACAAGCTCACCGGCTTCAAGAGTGTGCTGCTTGAG
ATGATCATCTACGCAACCTTGTTCATGCTGGCCCTCGACAACTCCATCGTCGCCATCCTGCAGCCGTCCATCGCG
TACCAGTTCCGGGCCCTCGACAAATTTCCATGGCTCGCTGTTGGACACCAGCTCGGCGGGTTGACCGCGGCTATG
CCGCTGGCAAAACTCTACTCCGTCTTCGATGCTAAGCCGCTCTTCCTCCTCTTCACTGTCGCGTTCTTGGGGGCC
TCGGCGCTGAGCGGCACGGCTGTGAACATGGCGTCTGAGATTGTCGGCCGCGTCTGGGCCGGCATCGCTGTCACG
GGCATGCGTTGCGGCCTTCTGCTCATCCACAAACGCAACCTGGTGGAGAAGGAACGACATGCGGCATGCCCCGAT
CCGTTGACTATCGTCTGGGCCCTGGGATCTCTCCTCGGTCCCGTCGTGGGCGGCGCGCTCGCGCTGGCCTCGTGG
CGCTGGGCCTTCTACATGAACCTCTTCCCCATTCTGATCATCCTGCCCGTGTGCATCCTCATCGTGCCATCCCGC
CCGTCGGTCCGCCAAGGCTCAACAAGCCGTCACCTCGAAGCTTTGGATCCCATGGGGATACTCCTCAGCGTCGTC
TCCATGACCACATTCGCCGCCGCGACCAACCTCGCCGGGGTGCTGTTCAGCTGGAAAGGCTCCAACGTCATCATT
CTCTACGCCGTGAGCGCCATCTGCTGCGTCGGCTTTGCCCTTCAGCAAACCTTTTGCATCTTCACCACGGCCTCG
AATCAGCTGGTCCCCATTCCGCTCCTGGGCAGCCGGGAGGCTATGATCAACTACTTCTTTGTGTCGTGCGGCAGC
ACCATGGCATATATCACGACAAACTACGTGCCCATCTACTTGGAACTGATTAGGGGCGCGTCGCCTGCCCAGACG
GCGGGGCGGACGCTGCCTCTCGGCTTCCTGCTCGCCATCAGCTTCCTCTTCAGCGAGAATCTTCGACATACCGCT
GTTTTCTACCGAACTTGGAGTGTTTTCGCCGCCGCCCTGGGCCTGGCTGGGGCTGTTCTCATGAGCAAGGTCAAC
GTCGACACGCCGACCGCGACCATCAGCGGCTACCAGACCATACTCGGAATCGGCGCAGGATGCTTCGCCCATGCC
GGCTTCGTCTCCGTCCAAACCAGCCTCTACCCGGGACACGACACTTCCGACGCCGCTCTCATGCTGGTGGCTCAG
CTAGGCGGGTCGACCATCGGCCTCTCCCTGGCCGGGGCCATCTTCGTCAACACCGCCAAGAAGAGCCTGGCGAGC
CTGTTCCCGGAACTCGGCGCCGACGCCCTCGATCTGGTCATGGCGGGCGCCAGTGGGGACTTTCTGTCTAATCTG
AGGGCGAAAGACCAGGCGTTGGCGCTCGACTGCATTGTCGAGGCGCTTCGGAAGGTCTTCATTCACGCCTACGCC
GCCTCTGCCGTGGCCATCTTCATGGGCGCCCTGATCGAGGCGGAATAG
Gene >Hirsu2|4437
ATGCCTCCTCGGCTAGCCGACACGTCGCTTGGCGTCTTCGAAGAGATCGACCTTGGGCCTCGCACCCCCCCTTCC
GGCCTCGGCACCGGGGCAGCTTTCCCCAACGTCCGGCTCGACAAGCTCACCGGCTTCAAGGTTCGCCCGGGCACA
TTCGTCTCCCATCTCTGACGAGGCGCGTGGCTGAGGTTGACCGCGCCGCTTGAACCCGTCGATAGAGTGTGCTGC
TTGAGATGATCATCTACGCAACCTTGTTCATGCTGGCCCTCGACAACTCCATCGTCGCCATCCTGCAGCCGGTAA
GCGTGCACTCTTCAGCCAACTCGTCCGCCACCACGCATGTGTGCCTCGAGCTCTGACATTGATTTTGCAGTCCAT
CGCGTACCAGTTCCGGGCCCTCGACAAATTTCCATGGCTCGCTGTTGGGTATAGTCACAAACGAAACAACCGGCT
CCGGGTCCCAGGCGAAGCATCTCCGGCCGGGACGGCGACGTTAACCCTCTTTCGTGTAGACACCAGCTCGGCGGG
TTGACCGCGGCTATGCCGCTGGCAAAACTCTACTCCGTCTTCGATGCTAAGCCGCTCTTCCTCCTCTTCACTGTC
GCGTTCTTGGGGGCCTCGGCGCTGAGCGGCACGGCTGTGAACATGGCGTCTGAGATTGTCGGCCGCGTCTGGGCC
GGCATCGCTGTCACGGGCATGCGTTGCGGCCTTCTGCTCATCCACAAACGCAACCTGGTGGAGAAGGAACGACAT
GCGGCATGCCCCGATCCGTTGTATGTGATGTCTATCCTTGAACCATTCAAAGCATCAATATCTCGTCGCTAACGT
CACGTCGCTTGCCTACGTCGGAGGACTATCGTCTGGGCCCTGGGATCTCTCCTCGGTCCCGTCGTGGGCGGCGCG
CTCGCGCTGGCCTCGTGGCGCTGGGCCTTCTACATGAACCTCTTCCCCATTCTGATCATCCTGCCCGTGTGCATC
CTCATCGTGCCATCCCGCCCGTCGGTCCGCCAAGGCTCAACAAGCCGTCACCTCGAAGCTTTGGATCCCATGGGG
ATACTCCTCAGCGTCGTCTCCATGACCACATTCGCCGCCGCGACCAACCTCGCCGGGGTGCTGTTCAGCTGGAAA
GGCTCCAACGTCATCATTCTCTACGCCGTGAGCGCCATCTGCTGCGTCGGCTTTGCCCTTCAGCAAACCTTTTGC
ATCTTCACCACGGCCTCGAATCAGCTGGTCCCCATTCCGCTCCTGGGCAGCCGGGAGGCTATGATCAACTACTTC
TTTGTGTCGTGCGGCAGCACCATGGCATATATCACGACAAACTACGTGCCCATCTACTTGGAACTGATTAGGGGC
GCGTCGCCTGCCCAGACGGCGGGGCGGACGCTGCCTCTCGGCTTCCTGCTCGCCATCAGCTTCCTCTTCAGCGAG
AATCTTCGACATACCGCTGTTTTCTACCGAACTTGGAGTGTTTTCGCCGCCGCCCTGGGCCTGGCTGGGGCTGTT
CTCATGAGTGAGTTGATTTCTTTTTCAACTCGGTCCCCTCTCACCTCCCCCAGAAGAGGACCGGAGCCTGCCATG
ATGCTAACTTGGAATGAAGGCAAGGTCAACGTCGACACGCCGACCGCGACCATCAGCGGCTACCAGACCATACTC
GGAATCGGCGCAGGATGCTTCGCCCATGCCGGCTTCGTCTCCGTCCAAACCAGCCTCTACCCGGGACACGACACT
TCCGACGCCGCTCTCATGCTGGTGGCTCAGCTAGGCGGGTCGACCATCGGCCTCTCCCTGGCCGGGGCCATCTTC
GTCAACACCGCCAAGAAGAGCCTGGCGAGCCTGTTCCCGGAACTCGGCGCCGACGCCCTCGATCTGGTCATGGCG
GGCGCCAGTGGGGACTTTCTGTCTAATCTGAGGGCGAAAGACCAGGCGTTGGCGCTCGACTGCATTGTCGAGGCG
CTTCGGAAGGTCTTCATTCACGCCTACGCCGCCTCTGCCGTGGCCATCTTCATGGGCGCCCTGATCGAGGCGGAA
TAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail