Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4435
Gene name
LocationContig_226:18443..20227
Strand-
Gene length (bp)1784
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.4E-16 59 305

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 3 437 2.0E-36
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 59 418 2.0E-06
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 64 418 5.0E-06
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 64 418 5.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 84 106 22
3 119 136 17
4 146 168 22
5 181 203 22
6 208 227 19
7 260 282 22
8 292 314 22
9 326 343 17
10 348 370 22
11 383 405 22
12 410 432 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4435
MSLSATATATASPDAAPASSASRLVEDGPGSDDGASVAQRPAERWNEPRANVGRLAFAFVSFIIAGMNDAAVGAL
IPYLEEFYGLSYTVVSLIFLTPFAGYSVAAFTNARIHMRLGQRGVAVMAPLCHVATYAILAAHPPYPVLVVANAI
SGFGNGLEDACFCAWVGAMDKGNSIQGLMHSCYSLGALFAPLIATSMVVQAGLPWYDFYFVMVGMAVLELVGLVV
FFWDKTGAVYREEHAGEADSSGAGTREALKSRVTWLCALFFFAYMGAEVGLGGWIVTFMLRVRHASPIASGISGS
GFWAGMALGRAGLGFVTERYGERLCISLYLAACLALELLFWLVPQFVVSAVAVALLGFFLGPMFPSAVMVTAKLL
PRRIHVSAIGFAMAMGGTGGTVFPFIIGAIAASRGVAVLQPVVLALIVLILLVWLSFPRIQKKD*
Coding >Hirsu2|4435
ATGTCCCTGTCGGCGACGGCGACGGCGACGGCCAGCCCGGACGCGGCGCCCGCGTCCTCGGCCTCGCGCCTGGTG
GAGGACGGGCCGGGCTCGGACGATGGCGCGTCCGTGGCCCAGCGGCCGGCCGAGCGGTGGAACGAGCCGCGGGCC
AACGTCGGCCGGCTGGCGTTTGCGTTTGTGTCGTTCATCATTGCCGGCATGAACGATGCCGCTGTCGGTGCCTTG
ATCCCCTATCTGGAGGAGTTCTACGGACTCAGCTACACCGTCGTCTCGCTCATCTTCCTGACGCCCTTCGCCGGC
TACTCGGTCGCCGCCTTCACCAACGCCCGCATCCACATGCGGCTCGGGCAGCGCGGCGTGGCCGTCATGGCGCCG
CTGTGCCACGTCGCCACGTACGCCATCCTGGCCGCCCATCCGCCCTACCCGGTCCTGGTCGTGGCCAACGCCATC
AGCGGCTTCGGCAACGGCCTCGAGGACGCCTGCTTCTGCGCCTGGGTCGGCGCCATGGACAAGGGAAACTCCATC
CAGGGCCTGATGCACTCGTGCTACTCGCTCGGCGCCCTGTTCGCGCCGCTCATCGCCACCTCCATGGTCGTCCAG
GCCGGGCTGCCGTGGTACGACTTTTACTTCGTCATGGTCGGCATGGCGGTCCTCGAGCTCGTCGGCCTCGTCGTC
TTCTTCTGGGATAAGACCGGCGCCGTCTACCGGGAGGAACACGCCGGAGAGGCCGACTCGTCCGGCGCCGGGACG
CGCGAGGCGCTCAAGTCGCGCGTCACCTGGCTGTGCGCCCTGTTCTTCTTTGCCTACATGGGTGCCGAAGTCGGC
CTCGGAGGCTGGATCGTCACCTTCATGCTCCGCGTCCGGCACGCCTCGCCCATCGCCTCCGGCATCTCCGGCTCC
GGCTTCTGGGCCGGCATGGCCCTGGGCCGGGCCGGGCTGGGCTTCGTGACGGAGCGCTACGGCGAGCGGCTCTGC
ATCAGCCTCTACCTGGCCGCCTGCCTCGCGCTCGAGCTGCTCTTCTGGCTCGTGCCGCAGTTCGTCGTCTCCGCC
GTCGCCGTCGCCCTGCTCGGCTTCTTCCTCGGGCCCATGTTCCCCAGCGCCGTCATGGTCACGGCCAAGCTGCTG
CCGCGCCGCATCCACGTCAGCGCCATCGGCTTCGCCATGGCCATGGGCGGCACCGGCGGCACCGTCTTCCCCTTT
ATCATCGGCGCCATCGCCGCCAGCAGGGGCGTCGCCGTGCTGCAGCCCGTCGTGCTCGCCCTCATCGTCCTCATC
CTGCTCGTCTGGCTCAGCTTCCCGCGCATCCAGAAGAAGGACTGA
Transcript >Hirsu2|4435
ATGTCCCTGTCGGCGACGGCGACGGCGACGGCCAGCCCGGACGCGGCGCCCGCGTCCTCGGCCTCGCGCCTGGTG
GAGGACGGGCCGGGCTCGGACGATGGCGCGTCCGTGGCCCAGCGGCCGGCCGAGCGGTGGAACGAGCCGCGGGCC
AACGTCGGCCGGCTGGCGTTTGCGTTTGTGTCGTTCATCATTGCCGGCATGAACGATGCCGCTGTCGGTGCCTTG
ATCCCCTATCTGGAGGAGTTCTACGGACTCAGCTACACCGTCGTCTCGCTCATCTTCCTGACGCCCTTCGCCGGC
TACTCGGTCGCCGCCTTCACCAACGCCCGCATCCACATGCGGCTCGGGCAGCGCGGCGTGGCCGTCATGGCGCCG
CTGTGCCACGTCGCCACGTACGCCATCCTGGCCGCCCATCCGCCCTACCCGGTCCTGGTCGTGGCCAACGCCATC
AGCGGCTTCGGCAACGGCCTCGAGGACGCCTGCTTCTGCGCCTGGGTCGGCGCCATGGACAAGGGAAACTCCATC
CAGGGCCTGATGCACTCGTGCTACTCGCTCGGCGCCCTGTTCGCGCCGCTCATCGCCACCTCCATGGTCGTCCAG
GCCGGGCTGCCGTGGTACGACTTTTACTTCGTCATGGTCGGCATGGCGGTCCTCGAGCTCGTCGGCCTCGTCGTC
TTCTTCTGGGATAAGACCGGCGCCGTCTACCGGGAGGAACACGCCGGAGAGGCCGACTCGTCCGGCGCCGGGACG
CGCGAGGCGCTCAAGTCGCGCGTCACCTGGCTGTGCGCCCTGTTCTTCTTTGCCTACATGGGTGCCGAAGTCGGC
CTCGGAGGCTGGATCGTCACCTTCATGCTCCGCGTCCGGCACGCCTCGCCCATCGCCTCCGGCATCTCCGGCTCC
GGCTTCTGGGCCGGCATGGCCCTGGGCCGGGCCGGGCTGGGCTTCGTGACGGAGCGCTACGGCGAGCGGCTCTGC
ATCAGCCTCTACCTGGCCGCCTGCCTCGCGCTCGAGCTGCTCTTCTGGCTCGTGCCGCAGTTCGTCGTCTCCGCC
GTCGCCGTCGCCCTGCTCGGCTTCTTCCTCGGGCCCATGTTCCCCAGCGCCGTCATGGTCACGGCCAAGCTGCTG
CCGCGCCGCATCCACGTCAGCGCCATCGGCTTCGCCATGGCCATGGGCGGCACCGGCGGCACCGTCTTCCCCTTT
ATCATCGGCGCCATCGCCGCCAGCAGGGGCGTCGCCGTGCTGCAGCCCGTCGTGCTCGCCCTCATCGTCCTCATC
CTGCTCGTCTGGCTCAGCTTCCCGCGCATCCAGAAGAAGGACTGA
Gene >Hirsu2|4435
ATGTCCCTGTCGGCGACGGCGACGGCGACGGCCAGCCCGGACGCGGCGCCCGCGTCCTCGGCCTCGCGCCTGGTG
GAGGACGGGCCGGGCTCGGACGATGGCGCGTCCGTGGCCCAGCGGCCGGCCGAGCGGTGGAACGAGCCGCGGGCC
AACGTCGGCCGGCTGGCGTTTGCGTTTGTGTCGTTCATCATTGCCGGCATGAACGATGCCGCTGTCGGTGTACGT
CTGTGTCCCGTCGCTGCCGTGGGGCGGGATGAGCGCAGCGGTTTGGTGTTGTTGATAGATGTCGTCTCCCGGCTG
ACCACTCCTTGCTTGACAGGCCTTGATCCCCTATGTACGTCGTCAACGGCTCTGGATCTCTCCGTCCGGCCCGGG
GCAGTGACGCCATGTCCGCTCGGGGGCTTGCGAGCAACTGAAAGACTCAAACAGTCTGCGTCCAAGGTCTGATCC
GCTGACGAGGAACGGGGGACTCGATAGCTGGAGGAGTTCTACGGACTCAGCTACACCGTCGTCTCGCTCATCTTC
CTGACGCCCTTCGCCGGCTACTCGGTCGCCGCCTTCACCAACGCCCGCATCCACATGCGGCTCGGGCAGCGCGGC
GTGGCCGTCATGGCGCCGCTGTGCCACGTCGCCACGTACGCCATCCTGGCCGCCCATCCGCCCTACCCGGTCCTG
GTCGTGGCCAACGCCATCAGCGGCTTCGGCAACGGCCTCGAGGACGCCTGCTTCTGCGCCTGGGTCGGCGCCATG
GACAAGGGAAACTCCATCCAGGGCCTGATGCACTCGTGCTACTCGCTCGGCGCCCTGTTCGCGCCGCTCATCGCC
ACCTCCATGGTCGTCCAGGCCGGGCTGCCGTGGTACGACTTTTACTTCGTCATGGTGCGTCTGTCTACTCCTTGT
CGTCTCGAATATCACCTCTTCACTCTCCGTCCGATGGCGGCCTTGGGTTCTGTTCTGACCGGGGCCCCGTTGCAT
CCGCGCCTGTCTTGCAGGTCGGCATGGCGGTCCTCGAGCTCGTCGGCCTCGTCGTCTTCTTCTGGGATAAGACCG
GCGCCGTCTACCGGGAGGAACACGCCGGAGAGGCCGACTCGTCCGGCGCCGGGACGCGCGAGGCGCTCAAGTCGC
GCGTCACCTGGCTGTGCGCCCTGTTCTTCTTTGCCTACATGGGTGCCGAAGGTACGGTCGCGTCTCACCTCACTT
GCTTCCATCTCTCTTCCCTGCGCCCCTTGAGCGGTTCTCGGTCAGCCTCGGTGCCCTCTCACGTCCCAATGCTGA
CCCGCGCAGTCGGCCTCGGAGGCTGGATCGTCACCTTCATGCTCCGCGTCCGGCACGCCTCGCCCATCGCCTCCG
GCATCTCCGGCTCCGGCTTCTGGGCCGGCATGGCCCTGGGCCGGGCCGGGCTGGGCTTCGTGACGGAGCGCTACG
GCGAGCGGCTCTGCATCAGCCTCTACCTGGCCGCCTGCCTCGCGCTCGAGCTGCTCTTCTGGCTCGTGCCGCAGT
TCGTCGTCTCCGCCGTCGCCGTCGCCCTGCTCGGCTTCTTCCTCGGGCCCATGTTCCCCAGCGCCGTCATGGTCA
CGGCCAAGCTGCTGCCGCGCCGCATCCACGTCAGCGCCATCGGCTTCGCCATGGCCATGGGCGGCACCGGCGGCA
CCGTCTTCCCCTTTATCATCGGCGCCATCGCCGCCAGCAGGGGCGTCGCCGTGCTGCAGCCCGTCGTGCTCGCCC
TCATCGTCCTCATCCTGCTCGTCTGGCTCAGCTTCCCGCGCATCCAGAAGAAGGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail