Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4433
Gene name
LocationContig_226:14145..15097
Strand+
Gene length (bp)952
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13912 zf-C2H2_6 C2H2-type zinc finger 2.2E-03 94 114
PF12874 zf-met Zinc-finger of C2H2 type 3.1E-02 37 56

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 7 243 2.0E-11
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 7 225 1.0E-09
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 7 243 2.0E-09
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 7 243 3.0E-09
sp|Q2M1K9|ZN423_HUMAN Zinc finger protein 423 OS=Homo sapiens GN=ZNF423 PE=1 SV=1 26 221 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 7 243 2.0E-11
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 7 225 1.0E-09
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 7 243 2.0E-09
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 7 243 3.0E-09
sp|Q2M1K9|ZN423_HUMAN Zinc finger protein 423 OS=Homo sapiens GN=ZNF423 PE=1 SV=1 26 221 3.0E-09
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 7 225 3.0E-09
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 7 221 4.0E-09
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 7 139 8.0E-09
sp|P08970|SUHW_DROME Protein suppressor of hairy wing OS=Drosophila melanogaster GN=su(Hw) PE=1 SV=2 7 196 8.0E-09
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 24 244 8.0E-09
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 7 139 8.0E-09
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 8 139 9.0E-09
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 7 142 9.0E-09
sp|Q80TS5|ZN423_MOUSE Zinc finger protein 423 OS=Mus musculus GN=Znf423 PE=1 SV=2 26 221 1.0E-08
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 7 243 1.0E-08
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 37 156 2.0E-08
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 7 215 2.0E-08
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 7 214 3.0E-08
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 7 139 3.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 7 143 3.0E-08
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 7 243 3.0E-08
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 7 243 4.0E-08
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 31 246 5.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 7 243 5.0E-08
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 7 215 5.0E-08
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 7 243 5.0E-08
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 7 212 6.0E-08
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 7 243 6.0E-08
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 30 140 7.0E-08
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 7 243 7.0E-08
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 7 147 8.0E-08
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 7 243 8.0E-08
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 7 221 9.0E-08
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 7 243 9.0E-08
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 7 225 1.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 7 226 1.0E-07
sp|Q6IV72|ZN425_HUMAN Zinc finger protein 425 OS=Homo sapiens GN=ZNF425 PE=1 SV=1 6 244 1.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 7 246 1.0E-07
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 30 222 1.0E-07
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 7 139 1.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 36 142 1.0E-07
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 7 139 2.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 7 214 2.0E-07
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 7 140 2.0E-07
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 4 139 3.0E-07
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 6 246 3.0E-07
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 7 142 3.0E-07
sp|Q9N003|ZN425_MACFA Zinc finger protein 425 (Fragment) OS=Macaca fascicularis GN=ZNF425 PE=2 SV=2 6 244 3.0E-07
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 7 220 3.0E-07
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 7 139 3.0E-07
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 7 221 3.0E-07
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 7 140 3.0E-07
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 4 139 3.0E-07
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 7 245 4.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 7 142 4.0E-07
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 7 139 4.0E-07
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 7 139 4.0E-07
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 7 212 4.0E-07
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 36 243 4.0E-07
sp|Q9N003|ZN425_MACFA Zinc finger protein 425 (Fragment) OS=Macaca fascicularis GN=ZNF425 PE=2 SV=2 7 222 5.0E-07
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 7 222 5.0E-07
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 7 145 5.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 7 249 5.0E-07
sp|Q08876|SUHW_DROVI Protein suppressor of hairy wing OS=Drosophila virilis GN=su(Hw) PE=2 SV=1 37 221 5.0E-07
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 7 142 5.0E-07
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 7 243 5.0E-07
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 7 244 5.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 7 212 5.0E-07
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 7 243 6.0E-07
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 4 139 6.0E-07
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 7 139 6.0E-07
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 7 139 6.0E-07
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 7 243 6.0E-07
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 9 139 7.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 9 243 7.0E-07
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 9 139 7.0E-07
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 9 139 7.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 7 139 7.0E-07
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 7 272 8.0E-07
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 7 243 8.0E-07
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 7 243 8.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 7 221 9.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 7 244 9.0E-07
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 7 139 9.0E-07
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 7 212 9.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 7 142 1.0E-06
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 7 152 1.0E-06
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 7 243 1.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 7 140 1.0E-06
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 7 243 1.0E-06
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 7 148 1.0E-06
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 7 248 1.0E-06
sp|Q8BV42|ZN786_MOUSE Zinc finger protein 786 OS=Mus musculus GN=Znf786 PE=2 SV=1 7 243 1.0E-06
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 7 140 1.0E-06
sp|O08961|ZN423_RAT Zinc finger protein 423 OS=Rattus norvegicus GN=Znf423 PE=1 SV=2 26 221 1.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 7 139 1.0E-06
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 7 140 1.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 7 139 1.0E-06
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 7 145 1.0E-06
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 7 139 1.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 7 142 1.0E-06
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 1 139 1.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 7 246 2.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 7 225 2.0E-06
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 6 243 2.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 7 139 2.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 7 152 2.0E-06
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 7 139 2.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 7 140 2.0E-06
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 7 243 2.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 7 213 2.0E-06
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 7 142 2.0E-06
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 7 250 2.0E-06
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 7 145 2.0E-06
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 7 139 2.0E-06
sp|Q9UC07|ZNF69_HUMAN Zinc finger protein 69 OS=Homo sapiens GN=ZNF69 PE=1 SV=2 7 248 2.0E-06
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 7 243 2.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 7 140 2.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 7 139 2.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 7 243 2.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 7 142 2.0E-06
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 7 243 2.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 7 151 2.0E-06
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 7 139 2.0E-06
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 7 243 2.0E-06
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 2 243 3.0E-06
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 7 225 3.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 7 139 3.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 7 139 3.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 7 142 3.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 7 244 3.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 7 142 3.0E-06
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 7 139 3.0E-06
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 7 139 3.0E-06
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 7 243 3.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 7 142 3.0E-06
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 9 220 3.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 30 246 3.0E-06
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 7 212 3.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 7 142 3.0E-06
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 7 243 3.0E-06
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 7 139 3.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 7 142 3.0E-06
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 7 243 4.0E-06
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 7 139 4.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 7 248 4.0E-06
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 7 139 4.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 7 212 4.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 7 246 4.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 7 142 4.0E-06
sp|Q15940|ZNF67_HUMAN Putative zinc finger protein 726P1 OS=Homo sapiens GN=ZNF726P1 PE=5 SV=2 6 139 4.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 7 212 4.0E-06
sp|Q9Z1D7|ZSC12_MOUSE Zinc finger and SCAN domain-containing protein 12 OS=Mus musculus GN=Zscan12 PE=2 SV=2 9 144 4.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 7 243 4.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 7 212 5.0E-06
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 7 152 5.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 7 139 5.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 7 140 5.0E-06
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 6 243 5.0E-06
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 7 244 5.0E-06
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 7 139 5.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 7 243 5.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 7 225 5.0E-06
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 7 139 5.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 7 142 5.0E-06
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 37 248 5.0E-06
sp|Q08875|SUHW_DROAN Protein suppressor of hairy wing OS=Drosophila ananassae GN=su(Hw) PE=2 SV=1 7 143 5.0E-06
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 7 243 5.0E-06
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 6 139 5.0E-06
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 37 156 5.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 4 144 5.0E-06
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 6 130 6.0E-06
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 36 139 6.0E-06
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 7 142 6.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 7 243 6.0E-06
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 37 139 6.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 7 245 6.0E-06
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 9 248 6.0E-06
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 21 230 6.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 7 142 6.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 7 142 6.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 7 244 6.0E-06
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 7 139 6.0E-06
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 37 246 6.0E-06
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 7 212 6.0E-06
sp|A1L1R6|ZN423_DANRE Zinc finger protein 423 OS=Danio rerio GN=znf423 PE=2 SV=1 37 226 6.0E-06
sp|Q60585|ZFP30_MOUSE Zinc finger protein 30 OS=Mus musculus GN=Zfp30 PE=2 SV=2 7 243 6.0E-06
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 37 139 7.0E-06
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 7 243 7.0E-06
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 7 139 7.0E-06
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 7 243 7.0E-06
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 8 142 7.0E-06
sp|Q802Y8|ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio GN=zbtb16a PE=1 SV=1 7 139 7.0E-06
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 7 225 7.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 7 243 7.0E-06
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 7 168 7.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 7 212 7.0E-06
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 7 139 7.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 7 250 7.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 7 243 8.0E-06
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 7 243 8.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 7 142 8.0E-06
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 7 212 8.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 7 139 8.0E-06
sp|Q8N393|ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens GN=ZNF786 PE=2 SV=2 7 143 8.0E-06
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 7 243 8.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 7 212 8.0E-06
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 7 139 8.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 7 139 8.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 7 139 9.0E-06
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 7 139 9.0E-06
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 7 244 9.0E-06
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 7 168 9.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 6 142 9.0E-06
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 7 244 9.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 7 140 9.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 7 139 9.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 7 139 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4433
MAVAFDFECGTCGKGFPGGWRARESHCNATGHARPAFECDVCPRWFNSQLACNQHMMDTGHWPTVEQYECGFCRD
TWSTEEQRDEHERRDHNYCAECDRCFMSYNNLTMHLRSHAHRGRPVECPFCRRHFAAAAGLTNHLETGACTHAAD
LDRDAMYRFVRRKDPCGLLSKDLVGWDGSDEYRASDRAWNGAAYECYLCHREFALLAGLNQHLNSPRHQQPLYHC
PNQNCCMDFRSLAAIINHLESEACGCTRFDTVQRKIGDLVTGDRMITF*
Coding >Hirsu2|4433
ATGGCCGTCGCTTTCGACTTCGAGTGCGGCACCTGCGGCAAGGGCTTCCCGGGCGGCTGGCGGGCGCGCGAGAGC
CACTGCAACGCGACGGGCCACGCGCGGCCGGCCTTCGAGTGCGACGTGTGCCCGCGCTGGTTCAACAGCCAGCTG
GCCTGCAACCAGCACATGATGGACACGGGCCATTGGCCGACGGTCGAGCAGTACGAGTGCGGCTTCTGCCGCGAC
ACGTGGTCGACCGAGGAGCAGCGCGACGAGCACGAGCGGCGCGACCACAACTACTGCGCCGAGTGCGACCGCTGC
TTCATGAGCTACAACAACCTGACCATGCACCTCCGGTCGCACGCCCACCGCGGCCGCCCGGTCGAGTGCCCCTTC
TGCCGCCGCCACTTCGCCGCCGCCGCCGGCCTGACGAACCACCTCGAGACGGGCGCCTGCACCCACGCGGCCGAC
CTCGACCGCGACGCCATGTACCGCTTCGTCCGGCGCAAGGACCCGTGCGGCCTGCTGTCCAAGGACCTGGTCGGC
TGGGACGGCTCCGACGAGTACCGCGCCTCGGACCGGGCCTGGAACGGCGCCGCCTACGAGTGCTACCTCTGCCAC
CGCGAGTTCGCCCTGCTGGCTGGTCTCAACCAGCATCTCAACTCGCCTCGACACCAGCAGCCGCTGTACCATTGC
CCGAACCAGAACTGTTGCATGGACTTTCGGAGCCTGGCCGCCATCATCAACCACCTGGAGAGCGAGGCCTGCGGC
TGCACCCGTTTCGACACGGTCCAGCGCAAGATCGGGGACCTGGTCACCGGGGACCGCATGATTACCTTTTGA
Transcript >Hirsu2|4433
ATGGCCGTCGCTTTCGACTTCGAGTGCGGCACCTGCGGCAAGGGCTTCCCGGGCGGCTGGCGGGCGCGCGAGAGC
CACTGCAACGCGACGGGCCACGCGCGGCCGGCCTTCGAGTGCGACGTGTGCCCGCGCTGGTTCAACAGCCAGCTG
GCCTGCAACCAGCACATGATGGACACGGGCCATTGGCCGACGGTCGAGCAGTACGAGTGCGGCTTCTGCCGCGAC
ACGTGGTCGACCGAGGAGCAGCGCGACGAGCACGAGCGGCGCGACCACAACTACTGCGCCGAGTGCGACCGCTGC
TTCATGAGCTACAACAACCTGACCATGCACCTCCGGTCGCACGCCCACCGCGGCCGCCCGGTCGAGTGCCCCTTC
TGCCGCCGCCACTTCGCCGCCGCCGCCGGCCTGACGAACCACCTCGAGACGGGCGCCTGCACCCACGCGGCCGAC
CTCGACCGCGACGCCATGTACCGCTTCGTCCGGCGCAAGGACCCGTGCGGCCTGCTGTCCAAGGACCTGGTCGGC
TGGGACGGCTCCGACGAGTACCGCGCCTCGGACCGGGCCTGGAACGGCGCCGCCTACGAGTGCTACCTCTGCCAC
CGCGAGTTCGCCCTGCTGGCTGGTCTCAACCAGCATCTCAACTCGCCTCGACACCAGCAGCCGCTGTACCATTGC
CCGAACCAGAACTGTTGCATGGACTTTCGGAGCCTGGCCGCCATCATCAACCACCTGGAGAGCGAGGCCTGCGGC
TGCACCCGTTTCGACACGGTCCAGCGCAAGATCGGGGACCTGGTCACCGGGGACCGCATGATTACCTTTTGA
Gene >Hirsu2|4433
ATGGCCGTCGCTTTCGACTTCGAGTGCGGCACCTGCGGCAAGGGCTTCCCGGGCGGCTGGCGGGCGCGCGAGAGC
CACTGCAACGCGACGGGCCACGCGCGGCCGGCCTTCGAGTGCGACGTGTGCCCGCGCTGGTTCAACAGCCAGCTG
GCCTGCAACCAGCACATGATGGACACGGGCCATTGGCCGACGGTCGAGCAGTACGAGTGCGGCTTCTGCCGCGAC
ACGTGGTCGACCGAGGAGCAGCGCGACGAGCACGAGCGGCGCGACCACAACTACTGCGCCGAGTGCGACCGCTGC
TTCATGAGCTACAACAACCTGACCATGGTAGGCAGTGCCGTACCGCGCTGCTGTCCGGGGCGGGAGAGGCTGACC
GCGGCGGCGACGAACAGCACCTCCGGTCGCACGCCCACCGCGGCCGCCCGGTCGAGTGCCCCTTCTGCCGCCGCC
ACTTCGCCGCCGCCGCCGGCCTGACGAACCACCTCGAGACGGGCGCCTGCACCCACGCGGCCGACCTCGACCGCG
ACGCCATGTACCGCTTCGTCCGGCGCAAGGACCCGTGCGGCCTGCTGTCCAAGGACCTGGTCGGCTGGGACGGCT
CCGACGAGTACCGCGCCTCGGACCGGGCCTGGAACGGCGCCGCCTACGAGTGCTACCTCTGCCACCGCGAGTTCG
CCCTGCTGGCTGGTCTCAACCAGCATCTCAACTCGCCTCGACGTGAGTCCCTCGGCCCCCACCGACCTCGAGCCC
TTGCCGCCTGCTGATGCCTGTTGCGCGCGCAGACCAGCAGCCGCTGTACCATTGCCCGAACCAGAACTGTTGCAT
GGACTTTCGGAGCCTGGCCGCCATCATCAACCACCTGGAGAGCGAGGCCTGCGGCTGCACCCGTTTCGACACGGT
CCAGCGCAAGATCGGGGACCTGGTCACCGGGGACCGCATGATTACCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail