Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4420
Gene name
LocationContig_2255:958..2539
Strand-
Gene length (bp)1581
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03105 SPX SPX domain 6.7E-07 1 34

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38966|YD089_YEAST Uncharacterized protein YDR089W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR089W PE=1 SV=2 1 148 1.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 358 380 22
2 392 414 22
3 424 446 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4420
MKYGQQLEHESVPEWRLHNLDYNSLKHEIKAHTTRDQATAMAIPGHRDMALSRFEDSLYIELDRQHNRLDLFVTS
KADEISRRLEHLHFNIRRWIRKYADGDGTSISLKRQRRFAKYERELLRCGQDIFALSRFANAQVVAFRKILKKYR
KWTGSTSLSSRFSQDVLSNPKSFTRRDFTPLQVRHDEILCDLRAATPFFSEPSSPSTDAQSQPEPPSPRRTKVTF
DPLPPARFEPQVKYWNEYDDGSEGGGPEDDYAIYINPDDEADFPGLAYVRAITTVPYEKAKQWFERRKHGDEGRP
LLSSDQASTRSYSSTAVESEEEGYASSECVPHDGYATHYALPSISEQRLTRYREKMLVRGTAACFVASFVLLAIA
GLLIWAGRRRLRVEVDAGVTAGVMLSLACACTGLGMTLYRRDSLRLAYRAAVWCAFVAACLSNGMLLVLVLGSTA
*
Coding >Hirsu2|4420
ATGAAATACGGCCAGCAGCTCGAGCATGAGTCGGTTCCCGAATGGAGACTGCACAACCTCGACTACAACTCTCTC
AAGCATGAGATCAAGGCACACACAACGAGGGACCAGGCCACGGCCATGGCCATCCCTGGCCATCGGGACATGGCC
TTGAGCAGGTTCGAAGACAGCCTCTACATCGAGCTTGACCGGCAGCACAACCGCCTGGACCTCTTCGTCACCAGC
AAAGCCGATGAAATCTCGAGGCGACTCGAACATCTCCACTTCAACATTCGGCGCTGGATCCGCAAGTACGCCGAC
GGCGACGGCACCTCCATCTCGCTCAAGAGGCAGCGGAGGTTCGCCAAGTACGAGCGCGAGCTGCTGCGCTGCGGA
CAAGACATATTCGCCCTGTCGCGCTTCGCCAATGCCCAGGTCGTCGCATTCCGCAAGATCCTCAAGAAATACCGG
AAATGGACGGGCTCGACATCGCTGTCGTCGCGCTTCAGCCAAGACGTGCTCAGCAACCCCAAGAGCTTCACTCGG
CGCGACTTTACCCCGCTGCAGGTGCGGCACGACGAGATCCTGTGCGACCTGCGAGCGGCCACGCCCTTTTTCAGC
GAACCCAGCTCGCCCTCGACGGACGCGCAGTCGCAGCCCGAGCCGCCGAGCCCGAGGAGGACCAAGGTGACGTTC
GACCCGCTGCCGCCGGCGCGCTTCGAGCCCCAGGTCAAGTACTGGAACGAGTACGACGACGGGAGCGAGGGCGGC
GGGCCCGAGGACGACTACGCCATCTACATCAACCCCGACGACGAGGCCGACTTCCCCGGGCTCGCCTACGTGCGG
GCCATCACGACGGTGCCGTACGAAAAGGCCAAGCAGTGGTTCGAGCGGCGCAAGCACGGCGACGAGGGCCGGCCC
CTCCTGTCGTCGGACCAGGCGAGCACGCGCAGCTACTCGTCGACGGCGGTCGAGTCGGAGGAGGAGGGCTACGCC
AGCTCCGAGTGCGTGCCGCACGACGGCTACGCGACGCACTACGCGCTGCCGAGCATCAGCGAGCAGCGGCTGACG
CGCTACCGGGAGAAGATGCTGGTCCGGGGCACGGCCGCCTGCTTCGTCGCCTCCTTCGTGCTGCTGGCCATCGCC
GGCCTGCTGATCTGGGCGGGCCGCCGCCGGCTGCGCGTCGAGGTGGACGCGGGCGTGACGGCCGGCGTCATGCTC
AGCCTGGCCTGCGCCTGCACCGGGCTGGGCATGACGCTGTACCGGCGGGATTCGCTGCGGCTGGCGTACCGGGCG
GCCGTGTGGTGCGCCTTCGTCGCCGCCTGCCTGAGCAACGGGATGCTGCTGGTGCTGGTGCTGGGCAGCACGGCT
TGA
Transcript >Hirsu2|4420
ATGAAATACGGCCAGCAGCTCGAGCATGAGTCGGTTCCCGAATGGAGACTGCACAACCTCGACTACAACTCTCTC
AAGCATGAGATCAAGGCACACACAACGAGGGACCAGGCCACGGCCATGGCCATCCCTGGCCATCGGGACATGGCC
TTGAGCAGGTTCGAAGACAGCCTCTACATCGAGCTTGACCGGCAGCACAACCGCCTGGACCTCTTCGTCACCAGC
AAAGCCGATGAAATCTCGAGGCGACTCGAACATCTCCACTTCAACATTCGGCGCTGGATCCGCAAGTACGCCGAC
GGCGACGGCACCTCCATCTCGCTCAAGAGGCAGCGGAGGTTCGCCAAGTACGAGCGCGAGCTGCTGCGCTGCGGA
CAAGACATATTCGCCCTGTCGCGCTTCGCCAATGCCCAGGTCGTCGCATTCCGCAAGATCCTCAAGAAATACCGG
AAATGGACGGGCTCGACATCGCTGTCGTCGCGCTTCAGCCAAGACGTGCTCAGCAACCCCAAGAGCTTCACTCGG
CGCGACTTTACCCCGCTGCAGGTGCGGCACGACGAGATCCTGTGCGACCTGCGAGCGGCCACGCCCTTTTTCAGC
GAACCCAGCTCGCCCTCGACGGACGCGCAGTCGCAGCCCGAGCCGCCGAGCCCGAGGAGGACCAAGGTGACGTTC
GACCCGCTGCCGCCGGCGCGCTTCGAGCCCCAGGTCAAGTACTGGAACGAGTACGACGACGGGAGCGAGGGCGGC
GGGCCCGAGGACGACTACGCCATCTACATCAACCCCGACGACGAGGCCGACTTCCCCGGGCTCGCCTACGTGCGG
GCCATCACGACGGTGCCGTACGAAAAGGCCAAGCAGTGGTTCGAGCGGCGCAAGCACGGCGACGAGGGCCGGCCC
CTCCTGTCGTCGGACCAGGCGAGCACGCGCAGCTACTCGTCGACGGCGGTCGAGTCGGAGGAGGAGGGCTACGCC
AGCTCCGAGTGCGTGCCGCACGACGGCTACGCGACGCACTACGCGCTGCCGAGCATCAGCGAGCAGCGGCTGACG
CGCTACCGGGAGAAGATGCTGGTCCGGGGCACGGCCGCCTGCTTCGTCGCCTCCTTCGTGCTGCTGGCCATCGCC
GGCCTGCTGATCTGGGCGGGCCGCCGCCGGCTGCGCGTCGAGGTGGACGCGGGCGTGACGGCCGGCGTCATGCTC
AGCCTGGCCTGCGCCTGCACCGGGCTGGGCATGACGCTGTACCGGCGGGATTCGCTGCGGCTGGCGTACCGGGCG
GCCGTGTGGTGCGCCTTCGTCGCCGCCTGCCTGAGCAACGGGATGCTGCTGGTGCTGGTGCTGGGCAGCACGGCT
TGA
Gene >Hirsu2|4420
ATGAAATACGGCCAGCAGCTCGAGCATGAGTCGGTTCCCGAATGGAGACTGCGTATGTCTCTCCTCAGTCCCCCG
TGCCCTCGTCTTTCTTCTTCCGGCCGCCTTCGTCAGCAGGCGCCGCGCTAACCGCCGCTGCCGGCAGACAACCTC
GACTACAACTCTCTCAAGCATGAGATCAAGGCACACACAACGAGGGACCAGGCCACGGCCATGGCCATCCCTGGC
CATCGGGACATGGCCTTGAGCAGGTTCGAAGACAGCCTCTACATCGAGCTTGACCGGCAGCACAACCGCCTGGAC
CTCTTCGTCACCAGCAAAGCCGATGAAATCTCGAGGCGACTCGGTGCGTCTCGTCCCCCCTCTCCCGCCCGCTTG
CGACCGGGGCAAGGCCCAACTGACCGAGGCCCAAAAGAACATCTCCACTTCAACATTCGGCGCTGGATCCGCAAG
TACGCCGACGGCGACGGCACCTCCATCTCGCTCAAGAGGCAGCGGAGGTTCGCCAAGTACGAGCGCGAGCTGCTG
CGCTGCGGACAAGACATATTCGCCCTGTCGCGCTTCGCCAATGCCCAGGTCGTCGCATTCCGCAAGATCCTCAAG
AAATACCGGGTAGGTTGCCCGGACCGGACGCGGCGCAGATGGCCCGAGGCTGAGCTGACCTGTCTCCGTCTGCCT
CAGAAATGGACGGGCTCGACATCGCTGTCGTCGCGCTTCAGCCAAGACGTGCTCAGCAACCCCAAGAGCTTCACT
CGGCGCGACTTTACCCCGCTGCAGGTGCGGCACGACGAGATCCTGTGCGACCTGCGAGCGGCCACGCCCTTTTTC
AGCGAACCCAGCTCGCCCTCGACGGACGCGCAGTCGCAGCCCGAGCCGCCGAGCCCGAGGAGGACCAAGGTGACG
TTCGACCCGCTGCCGCCGGCGCGCTTCGAGCCCCAGGTCAAGTACTGGAACGAGTACGACGACGGGAGCGAGGGC
GGCGGGCCCGAGGACGACTACGCCATCTACATCAACCCCGACGACGAGGCCGACTTCCCCGGGCTCGCCTACGTG
CGGGCCATCACGACGGTGCCGTACGAAAAGGCCAAGCAGTGGTTCGAGCGGCGCAAGCACGGCGACGAGGGCCGG
CCCCTCCTGTCGTCGGACCAGGCGAGCACGCGCAGCTACTCGTCGACGGCGGTCGAGTCGGAGGAGGAGGGCTAC
GCCAGCTCCGAGTGCGTGCCGCACGACGGCTACGCGACGCACTACGCGCTGCCGAGCATCAGCGAGCAGCGGCTG
ACGCGCTACCGGGAGAAGATGCTGGTCCGGGGCACGGCCGCCTGCTTCGTCGCCTCCTTCGTGCTGCTGGCCATC
GCCGGCCTGCTGATCTGGGCGGGCCGCCGCCGGCTGCGCGTCGAGGTGGACGCGGGCGTGACGGCCGGCGTCATG
CTCAGCCTGGCCTGCGCCTGCACCGGGCTGGGCATGACGCTGTACCGGCGGGATTCGCTGCGGCTGGCGTACCGG
GCGGCCGTGTGGTGCGCCTTCGTCGCCGCCTGCCTGAGCAACGGGATGCTGCTGGTGCTGGTGCTGGGCAGCACG
GCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail