Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4419
Gene name
LocationContig_2254:280..1066
Strand-
Gene length (bp)786
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 1.6E-09 88 174
PF13649 Methyltransf_25 Methyltransferase domain 9.8E-08 88 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10224|TRM9_SCHPO tRNA (carboxymethyluridine(34)-5-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm9 PE=3 SV=1 47 259 4.0E-68
sp|P49957|TRM9_YEAST tRNA (carboxymethyluridine(34)-5-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM9 PE=1 SV=1 48 258 2.0E-65
sp|Q07G10|ALKB8_XENTR Alkylated DNA repair protein alkB homolog 8 OS=Xenopus tropicalis GN=alkbh8 PE=2 SV=2 39 258 2.0E-42
sp|Q08DH3|K1456_BOVIN Probable tRNA methyltransferase 9-like protein OS=Bos taurus PE=2 SV=1 48 207 2.0E-41
sp|Q80WQ4|K1456_MOUSE Probable tRNA methyltransferase 9-like protein OS=Mus musculus GN=Kiaa1456 PE=1 SV=1 44 207 9.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10224|TRM9_SCHPO tRNA (carboxymethyluridine(34)-5-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm9 PE=3 SV=1 47 259 4.0E-68
sp|P49957|TRM9_YEAST tRNA (carboxymethyluridine(34)-5-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM9 PE=1 SV=1 48 258 2.0E-65
sp|Q07G10|ALKB8_XENTR Alkylated DNA repair protein alkB homolog 8 OS=Xenopus tropicalis GN=alkbh8 PE=2 SV=2 39 258 2.0E-42
sp|Q08DH3|K1456_BOVIN Probable tRNA methyltransferase 9-like protein OS=Bos taurus PE=2 SV=1 48 207 2.0E-41
sp|Q80WQ4|K1456_MOUSE Probable tRNA methyltransferase 9-like protein OS=Mus musculus GN=Kiaa1456 PE=1 SV=1 44 207 9.0E-41
sp|Q9P272|K1456_HUMAN Probable tRNA methyltransferase 9-like protein OS=Homo sapiens GN=KIAA1456 PE=2 SV=3 48 207 6.0E-40
sp|Q96BT7|ALKB8_HUMAN Alkylated DNA repair protein alkB homolog 8 OS=Homo sapiens GN=ALKBH8 PE=1 SV=2 48 193 8.0E-38
sp|Q95K79|ALKB8_MACFA Alkylated DNA repair protein alkB homolog 8 OS=Macaca fascicularis GN=ALKBH8 PE=2 SV=1 44 193 1.0E-37
sp|Q80Y20|ALKB8_MOUSE Alkylated DNA repair protein alkB homolog 8 OS=Mus musculus GN=Alkbh8 PE=1 SV=1 48 188 1.0E-37
sp|A1A4L5|ALKB8_BOVIN Alkylated DNA repair protein alkB homolog 8 OS=Bos taurus GN=ALKBH8 PE=2 SV=1 13 193 4.0E-37
sp|C4V9L5|Y1265_NOSCE Putative methyltransferase NCER_101265 OS=Nosema ceranae (strain BRL01) GN=NCER_101265 PE=3 SV=1 47 258 5.0E-28
sp|Q8STN5|Y9F0_ENCCU Putative methyltransferase ECU09_1500 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU09_1500 PE=3 SV=2 43 255 9.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4419
MAGSDLAGQGPFVRQGLSPASPATAAEKATAEATAGDGNEQRPPEAYEEAHVHSVYEAIAPHFSSTRHKPWPLVA
SFLLAQRPGSIGLDVGCGNGKYLPVNPAVHLLGSDRSAALVGLARAERGGEVVVADGLLLPYRPAAVDFVISVAV
VHHLSTRPRRRSAIAALLGCLRPNPDARALVYVWALEQGASRRGWDEGCRQDTLVPWVTRAKGTPPATYQRYYHL
YREGELEEDVGAAGGAVLESGYERDNWWVICTRGRD*
Coding >Hirsu2|4419
ATGGCAGGCTCAGACTTGGCAGGGCAAGGACCGTTCGTCCGGCAGGGGCTGTCTCCGGCCTCACCAGCGACGGCG
GCGGAGAAGGCGACGGCGGAGGCGACGGCGGGCGACGGAAATGAGCAGCGGCCGCCCGAGGCGTACGAGGAGGCC
CACGTCCACAGCGTCTACGAGGCGATCGCGCCGCACTTCTCGTCGACGCGGCACAAGCCGTGGCCCCTGGTCGCC
AGCTTCCTCCTCGCGCAGCGCCCCGGCAGCATCGGGCTCGACGTCGGCTGCGGCAACGGCAAGTACCTGCCCGTC
AACCCGGCCGTCCACCTGCTCGGCTCCGACCGCAGCGCCGCGCTGGTCGGCCTCGCCCGGGCCGAGCGCGGCGGC
GAGGTGGTGGTGGCGGACGGCCTGCTGCTGCCGTACCGCCCGGCCGCCGTCGACTTCGTCATCAGCGTCGCTGTC
GTCCACCACCTGTCGACCCGGCCGCGGCGCCGTTCCGCCATCGCGGCCCTGCTGGGCTGCCTCCGGCCGAACCCC
GACGCCCGCGCCCTCGTCTACGTCTGGGCCCTCGAGCAGGGTGCCAGCCGTCGGGGCTGGGATGAGGGCTGCCGG
CAGGACACGCTGGTGCCGTGGGTGACGCGCGCGAAGGGCACGCCGCCCGCCACCTACCAGCGCTACTACCACCTG
TACCGCGAGGGCGAGCTGGAGGAGGACGTGGGCGCCGCCGGCGGCGCCGTGCTCGAGAGCGGCTACGAGAGGGAC
AACTGGTGGGTGATCTGTACACGTGGGCGAGACTGA
Transcript >Hirsu2|4419
ATGGCAGGCTCAGACTTGGCAGGGCAAGGACCGTTCGTCCGGCAGGGGCTGTCTCCGGCCTCACCAGCGACGGCG
GCGGAGAAGGCGACGGCGGAGGCGACGGCGGGCGACGGAAATGAGCAGCGGCCGCCCGAGGCGTACGAGGAGGCC
CACGTCCACAGCGTCTACGAGGCGATCGCGCCGCACTTCTCGTCGACGCGGCACAAGCCGTGGCCCCTGGTCGCC
AGCTTCCTCCTCGCGCAGCGCCCCGGCAGCATCGGGCTCGACGTCGGCTGCGGCAACGGCAAGTACCTGCCCGTC
AACCCGGCCGTCCACCTGCTCGGCTCCGACCGCAGCGCCGCGCTGGTCGGCCTCGCCCGGGCCGAGCGCGGCGGC
GAGGTGGTGGTGGCGGACGGCCTGCTGCTGCCGTACCGCCCGGCCGCCGTCGACTTCGTCATCAGCGTCGCTGTC
GTCCACCACCTGTCGACCCGGCCGCGGCGCCGTTCCGCCATCGCGGCCCTGCTGGGCTGCCTCCGGCCGAACCCC
GACGCCCGCGCCCTCGTCTACGTCTGGGCCCTCGAGCAGGGTGCCAGCCGTCGGGGCTGGGATGAGGGCTGCCGG
CAGGACACGCTGGTGCCGTGGGTGACGCGCGCGAAGGGCACGCCGCCCGCCACCTACCAGCGCTACTACCACCTG
TACCGCGAGGGCGAGCTGGAGGAGGACGTGGGCGCCGCCGGCGGCGCCGTGCTCGAGAGCGGCTACGAGAGGGAC
AACTGGTGGGTGATCTGTACACGTGGGCGAGACTGA
Gene >Hirsu2|4419
ATGGCAGGCTCAGACTTGGCAGGGCAAGGACCGTTCGTCCGGCAGGGGCTGTCTCCGGCCTCACCAGCGACGGCG
GCGGAGAAGGCGACGGCGGAGGCGACGGCGGGCGACGGAAATGAGCAGCGGCCGCCCGAGGCGTACGAGGAGGCC
CACGTCCACAGCGTCTACGAGGCGATCGCGCCGCACTTCTCGTCGACGCGGCACAAGCCGTGGCCCCTGGTCGCC
AGCTTCCTCCTCGCGCAGCGCCCCGGCAGCATCGGGCTCGACGTCGGCTGCGGCAACGGCAAGTACCTGCCCGTC
AACCCGGCCGTCCACCTGCTCGGCTCCGACCGCAGCGCCGCGCTGGTCGGCCTCGCCCGGGCCGAGCGCGGCGGC
GAGGTGGTGGTGGCGGACGGCCTGCTGCTGCCGTACCGCCCGGCCGCCGTCGACTTCGTCATCAGCGTCGCTGTC
GTCCACCACCTGTCGACCCGGCCGCGGCGCCGTTCCGCCATCGCGGCCCTGCTGGGCTGCCTCCGGCCGAACCCC
GACGCCCGCGCCCTCGTCTACGTCTGGGCCCTCGAGCAGGGTGCCAGCCGTCGGGGCTGGGATGAGGGCTGCCGG
CAGGACACGCTGGTGCCGTGGGTGACGCGCGCGAAGGGCACGCCGCCCGCCACCTACCAGCGCTACTACCACCTG
TACCGCGAGGGCGAGCTGGAGGAGGACGTGGGCGCCGCCGGCGGCGCCGTGCTCGAGAGCGGCTACGAGAGGGAC
AACTGGTGGGTGATCTGTACACGTGGGCGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail