Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4416
Gene name
LocationContig_2251:2401..3181
Strand-
Gene length (bp)780
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 7.1E-33 156 251
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 7.5E-13 3 56

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 1 257 4.0E-27
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 1 153 2.0E-18
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 1 94 5.0E-16
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 155 256 8.0E-07
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 11 86 3.0E-06

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 42 59 17
3 61 83 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4416
LGWSTLALALFYFAYRYNVFFVSDTAVDTQGLIYPRALKQLFTGIYLAEICMVGLFAISKAAGPAVLMAIFLVFT
ILFHITMSKHLDPLLYGLPRSVQAQEQAIREGGDDELAEAAGLPPTKEPRATSTDGKMAGLATAVSSESGPPKRG
NLVSRFFQPWRYNDFATMRRMMPREDDMELDRQYTDQVEATAYLPPSVSSETPTLWIPEDAAGVSKQEIALTSKV
IPITDEGATLDAKNNIIWDTEGARPPIWDEKITY*
Coding >Hirsu2|4416
CTGGGCTGGTCGACGCTGGCGCTCGCCCTCTTCTACTTCGCCTACCGCTACAACGTCTTCTTCGTCTCGGACACG
GCCGTCGACACGCAGGGCCTCATCTACCCCCGCGCGCTCAAGCAGCTGTTCACGGGCATCTACCTGGCCGAGATC
TGCATGGTCGGCCTGTTCGCCATCTCCAAGGCGGCCGGCCCGGCCGTGCTCATGGCCATCTTCCTCGTCTTCACC
ATCCTCTTCCACATCACCATGTCCAAGCACCTGGACCCGCTCCTGTACGGGCTCCCGCGCAGCGTGCAGGCGCAG
GAGCAGGCCATCCGCGAGGGCGGCGACGACGAGCTGGCCGAGGCGGCCGGCCTGCCGCCGACCAAGGAGCCGCGC
GCGACGAGCACCGACGGCAAGATGGCCGGCCTGGCGACGGCCGTGTCGAGCGAGAGCGGCCCGCCCAAGCGGGGC
AACCTGGTCAGCCGCTTCTTCCAGCCGTGGCGGTACAACGACTTCGCGACGATGCGCCGGATGATGCCGCGCGAG
GACGACATGGAGCTGGACCGGCAGTACACGGACCAGGTGGAGGCGACGGCCTACCTGCCGCCGTCGGTCAGCAGC
GAGACGCCGACGCTGTGGATCCCGGAGGACGCGGCCGGCGTGTCGAAGCAGGAGATTGCGCTGACGAGCAAGGTG
ATTCCCATCACCGACGAGGGCGCCACGCTCGACGCCAAGAACAACATCATCTGGGACACGGAGGGGGCGCGGCCG
CCCATCTGGGACGAGAAGATCACCTACTAA
Transcript >Hirsu2|4416
CTGGGCTGGTCGACGCTGGCGCTCGCCCTCTTCTACTTCGCCTACCGCTACAACGTCTTCTTCGTCTCGGACACG
GCCGTCGACACGCAGGGCCTCATCTACCCCCGCGCGCTCAAGCAGCTGTTCACGGGCATCTACCTGGCCGAGATC
TGCATGGTCGGCCTGTTCGCCATCTCCAAGGCGGCCGGCCCGGCCGTGCTCATGGCCATCTTCCTCGTCTTCACC
ATCCTCTTCCACATCACCATGTCCAAGCACCTGGACCCGCTCCTGTACGGGCTCCCGCGCAGCGTGCAGGCGCAG
GAGCAGGCCATCCGCGAGGGCGGCGACGACGAGCTGGCCGAGGCGGCCGGCCTGCCGCCGACCAAGGAGCCGCGC
GCGACGAGCACCGACGGCAAGATGGCCGGCCTGGCGACGGCCGTGTCGAGCGAGAGCGGCCCGCCCAAGCGGGGC
AACCTGGTCAGCCGCTTCTTCCAGCCGTGGCGGTACAACGACTTCGCGACGATGCGCCGGATGATGCCGCGCGAG
GACGACATGGAGCTGGACCGGCAGTACACGGACCAGGTGGAGGCGACGGCCTACCTGCCGCCGTCGGTCAGCAGC
GAGACGCCGACGCTGTGGATCCCGGAGGACGCGGCCGGCGTGTCGAAGCAGGAGATTGCGCTGACGAGCAAGGTG
ATTCCCATCACCGACGAGGGCGCCACGCTCGACGCCAAGAACAACATCATCTGGGACACGGAGGGGGCGCGGCCG
CCCATCTGGGACGAGAAGATCACCTACTAA
Gene >Hirsu2|4416
CTGGGCTGGTCGACGCTGGCGCTCGCCCTCTTCTACTTCGCCTACCGCTACAACGTCTTCTTCGTCTCGGACACG
GCCGTCGACACGCAGGGCCTCATCTACCCCCGCGCGCTCAAGCAGCTGTTCACGGGCATCTACCTGGCCGAGATC
TGCATGGTCGGCCTGTTCGCCATCTCCAAGGCGGCCGGCCCGGCCGTGCTCATGGCCATCTTCCTCGTCTTCACC
ATCCTCTTCCACATCACCATGTCCAAGCACCTGGACCCGCTCCTGTACGGGCTCCCGCGCAGCGTGCAGGCGCAG
GAGCAGGCCATCCGCGAGGGCGGCGACGACGAGCTGGCCGAGGCGGCCGGCCTGCCGCCGACCAAGGAGCCGCGC
GCGACGAGCACCGACGGCAAGATGGCCGGCCTGGCGACGGCCGTGTCGAGCGAGAGCGGCCCGCCCAAGCGGGGC
AACCTGGTCAGCCGCTTCTTCCAGCCGTGGCGGTACAACGACTTCGCGACGATGCGCCGGATGATGCCGCGCGAG
GACGACATGGAGCTGGACCGGCAGTACACGGACCAGGTGGAGGCGACGGCCTACCTGCCGCCGTCGGTCAGCAGC
GAGACGCCGACGCTGTGGATCCCGGAGGACGCGGCCGGCGTGTCGAAGCAGGAGATTGCGCTGACGAGCAAGGTG
ATTCCCATCACCGACGAGGGCGCCACGCTCGACGCCAAGAACAACATCATCTGGGACACGGAGGGGGCGCGGCCG
CCCATCTGGGACGAGAAGATCACCTACTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail