Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4399
Gene name
LocationContig_2243:1762..3211
Strand-
Gene length (bp)1449
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 7.5E-12 341 461

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 1 466 3.0E-31
sp|Q29AU6|RUMI_DROPS O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura GN=rumi PE=3 SV=1 341 461 9.0E-08
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 336 461 3.0E-07
sp|Q9JHP7|KDEL1_MOUSE KDEL motif-containing protein 1 OS=Mus musculus GN=Kdelc1 PE=1 SV=1 342 461 2.0E-06
sp|A0NDG6|RUMI_ANOGA O-glucosyltransferase rumi homolog OS=Anopheles gambiae GN=AGAP004267 PE=3 SV=1 341 461 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4399
LRPYWALDARTLRRRAAAWHFVVRVRAGKASMKGDVGDRVPWLRLWTELISEFAGSLPDVDMPINYMDESRILLP
FDAVADLVRREARDRTMPRADQVAANFSGLRDVDEAGPGQPAYDPAWHGPGEQYWHLAVKACGPHTPAHGVGQGD
LSGPAAFPHHYRPSYGYKGYVQNWTAAKDPCLQPHIRQLHGTFIEPISLSSTEELIPLFGGSKLPLNNEILIPGA
MYLTKREFYSGGDSHGPSWVRKKDGLIWRGDGSGGRARPHNWQHFHRHRLVDMLNGTSVSLAEAAGGRAMAFELP
SGDLDPGFASVGAWLGTFADAAFVHLCPGDRCGFLEDRFAPVKELPMRKQFRYKFLPDADGNSFSARFRGFLRST
SLPLKATIYAEWHDDRLEPWLHFVPLDNTFRDLYAALGFFADGPGRPGDAAARFIAERGRQWAETVLRREDMRLY
MWRLLLEWARVCDDRRQLLGFVDDLAEGRTGQ*
Coding >Hirsu2|4399
CTGCGGCCGTACTGGGCCCTCGACGCCCGCACCCTGCGCCGCCGCGCCGCGGCCTGGCACTTCGTCGTCCGGGTC
CGGGCCGGCAAGGCTTCCATGAAGGGCGACGTCGGCGACCGCGTGCCGTGGCTGCGGCTATGGACGGAGCTGATA
TCCGAGTTCGCCGGCTCCCTTCCCGACGTCGACATGCCCATCAACTACATGGACGAGTCGCGGATCCTGCTGCCC
TTTGATGCCGTCGCCGACCTCGTCCGCCGCGAGGCCCGGGACCGCACCATGCCGCGGGCCGACCAGGTGGCCGCC
AACTTCTCCGGCCTGCGCGACGTCGACGAGGCCGGCCCCGGCCAGCCGGCCTACGACCCCGCCTGGCACGGCCCG
GGCGAGCAGTACTGGCATCTCGCCGTCAAGGCCTGCGGCCCGCACACGCCGGCCCACGGCGTCGGCCAGGGCGAC
CTCTCCGGGCCGGCCGCCTTCCCGCACCACTACCGCCCGAGCTACGGCTACAAGGGCTACGTGCAGAACTGGACG
GCGGCCAAGGACCCGTGCCTGCAGCCGCATATCCGCCAGCTGCACGGCACCTTTATCGAGCCCATCAGCCTGTCC
TCGACCGAGGAGCTGATCCCGCTCTTCGGCGGCTCTAAGCTGCCGCTTAATAACGAGATCCTGATCCCGGGCGCC
ATGTACCTGACCAAGCGCGAGTTCTACTCCGGCGGAGACAGCCACGGGCCGTCGTGGGTACGCAAGAAGGACGGC
CTCATCTGGCGCGGCGACGGCTCCGGCGGCCGCGCCCGGCCGCATAACTGGCAGCACTTCCACCGACACCGCCTC
GTCGACATGCTCAACGGCACCTCGGTCTCGCTCGCCGAGGCCGCCGGCGGCCGGGCCATGGCCTTCGAGCTCCCG
TCCGGCGATCTGGACCCGGGCTTTGCCTCCGTGGGGGCCTGGCTCGGCACCTTCGCCGACGCCGCCTTCGTCCAC
CTCTGCCCGGGCGACCGGTGCGGCTTCCTCGAAGACCGGTTCGCGCCCGTCAAGGAGCTGCCGATGCGGAAGCAG
TTCCGCTACAAGTTCCTGCCCGACGCCGACGGCAACTCCTTCAGTGCGCGCTTCCGCGGCTTCCTACGCTCGACG
AGCCTGCCGCTCAAGGCGACCATCTACGCCGAGTGGCACGACGACCGGCTCGAGCCGTGGCTGCACTTCGTGCCG
CTCGACAACACCTTCCGCGACTTATACGCCGCCCTCGGCTTCTTCGCCGACGGGCCGGGGCGGCCCGGCGACGCC
GCCGCGCGCTTTATCGCCGAGCGCGGCCGCCAGTGGGCCGAGACGGTCCTGAGGAGGGAGGATATGCGGCTCTAT
ATGTGGCGCCTGCTGCTCGAGTGGGCGCGCGTCTGCGACGACCGGCGCCAGCTGCTCGGCTTCGTCGACGACTTG
GCGGAGGGCCGGACGGGCCAATAG
Transcript >Hirsu2|4399
CTGCGGCCGTACTGGGCCCTCGACGCCCGCACCCTGCGCCGCCGCGCCGCGGCCTGGCACTTCGTCGTCCGGGTC
CGGGCCGGCAAGGCTTCCATGAAGGGCGACGTCGGCGACCGCGTGCCGTGGCTGCGGCTATGGACGGAGCTGATA
TCCGAGTTCGCCGGCTCCCTTCCCGACGTCGACATGCCCATCAACTACATGGACGAGTCGCGGATCCTGCTGCCC
TTTGATGCCGTCGCCGACCTCGTCCGCCGCGAGGCCCGGGACCGCACCATGCCGCGGGCCGACCAGGTGGCCGCC
AACTTCTCCGGCCTGCGCGACGTCGACGAGGCCGGCCCCGGCCAGCCGGCCTACGACCCCGCCTGGCACGGCCCG
GGCGAGCAGTACTGGCATCTCGCCGTCAAGGCCTGCGGCCCGCACACGCCGGCCCACGGCGTCGGCCAGGGCGAC
CTCTCCGGGCCGGCCGCCTTCCCGCACCACTACCGCCCGAGCTACGGCTACAAGGGCTACGTGCAGAACTGGACG
GCGGCCAAGGACCCGTGCCTGCAGCCGCATATCCGCCAGCTGCACGGCACCTTTATCGAGCCCATCAGCCTGTCC
TCGACCGAGGAGCTGATCCCGCTCTTCGGCGGCTCTAAGCTGCCGCTTAATAACGAGATCCTGATCCCGGGCGCC
ATGTACCTGACCAAGCGCGAGTTCTACTCCGGCGGAGACAGCCACGGGCCGTCGTGGGTACGCAAGAAGGACGGC
CTCATCTGGCGCGGCGACGGCTCCGGCGGCCGCGCCCGGCCGCATAACTGGCAGCACTTCCACCGACACCGCCTC
GTCGACATGCTCAACGGCACCTCGGTCTCGCTCGCCGAGGCCGCCGGCGGCCGGGCCATGGCCTTCGAGCTCCCG
TCCGGCGATCTGGACCCGGGCTTTGCCTCCGTGGGGGCCTGGCTCGGCACCTTCGCCGACGCCGCCTTCGTCCAC
CTCTGCCCGGGCGACCGGTGCGGCTTCCTCGAAGACCGGTTCGCGCCCGTCAAGGAGCTGCCGATGCGGAAGCAG
TTCCGCTACAAGTTCCTGCCCGACGCCGACGGCAACTCCTTCAGTGCGCGCTTCCGCGGCTTCCTACGCTCGACG
AGCCTGCCGCTCAAGGCGACCATCTACGCCGAGTGGCACGACGACCGGCTCGAGCCGTGGCTGCACTTCGTGCCG
CTCGACAACACCTTCCGCGACTTATACGCCGCCCTCGGCTTCTTCGCCGACGGGCCGGGGCGGCCCGGCGACGCC
GCCGCGCGCTTTATCGCCGAGCGCGGCCGCCAGTGGGCCGAGACGGTCCTGAGGAGGGAGGATATGCGGCTCTAT
ATGTGGCGCCTGCTGCTCGAGTGGGCGCGCGTCTGCGACGACCGGCGCCAGCTGCTCGGCTTCGTCGACGACTTG
GCGGAGGGCCGGACGGGCCAATAG
Gene >Hirsu2|4399
CTGCGGCCGTACTGGGCCCTCGACGCCCGCACCCTGCGCCGCCGCGCCGCGGCCTGGCACTTCGTCGTCCGGGTC
CGGGCCGGCAAGGCTTCCATGAAGGGCGACGTCGGCGACCGCGTGCCGTGGCTGCGGCTATGGACGGAGCTGATA
TCCGAGTTCGCCGGCTCCCTTCCCGACGTCGACATGCCCATCAACTACATGGACGAGTCGCGGATCCTGCTGCCC
TTTGATGCCGTCGCCGACCTCGTCCGCCGCGAGGCCCGGGACCGCACCATGCCGCGGGCCGACCAGGTGGCCGCC
AACTTCTCCGGCCTGCGCGACGTCGACGAGGCCGGCCCCGGCCAGCCGGCCTACGACCCCGCCTGGCACGGCCCG
GGCGAGCAGTACTGGCATCTCGCCGTCAAGGCCTGCGGCCCGCACACGCCGGCCCACGGCGTCGGCCAGGGCGAC
CTCTCCGGGCCGGCCGCCTTCCCGCACCACTACCGCCCGAGCTACGGCTACAAGGGCTACGTGCAGAACTGGACG
GCGGCCAAGGACCCGTGCCTGCAGCCGCATATCCGCCAGCTGCACGGCACCTTTATCGAGCCCATCAGCCTGTCC
TCGACCGAGGAGCTGATCCCGCTCTTCGGCGGCTCTAAGCTGCCGCTTAATAACGAGATCCTGATCCCGGGCGCC
ATGTACCTGACCAAGCGCGAGTTCTACTCCGGCGGAGACAGCCACGGGCCGTCGTGGGTACGCAAGAAGGACGGC
CTCATCTGGCGCGGCGACGGCTCCGGCGGCCGCGCCCGGCCGCATAACTGGCAGCACTTCCACCGACACCGCCTC
GTCGACATGCTCAACGGCACCTCGGTCTCGCTCGCCGAGGCCGCCGGCGGCCGGGCCATGGCCTTCGAGCTCCCG
TCCGGCGATCTGGACCCGGGCTTTGCCTCCGTGGGGGCCTGGCTCGGCACCTTCGCCGACGCCGCCTTCGTCCAC
CTCTGCCCGGGCGACCGGTGCGGCTTCCTCGAAGACCGGTTCGCGCCCGTCAAGGAGCTGCCGATGCGGAAGCAG
TTCCGCTACAAGTTCCTGCCCGACGCCGACGGCAACTCCTTCAGTGCGCGCTTCCGCGGCTTCCTACGCTCGACG
AGCCTGCCGCTCAAGGCGACCATCTACGCCGAGTGGCACGACGACCGGCTCGAGCCGTGGCTGCACTTCGTGCCG
CTCGACAACACCTTCCGCGACTTATACGCCGCCCTCGGCTTCTTCGCCGACGGGCCGGGGCGGCCCGGCGACGCC
GCCGCGCGCTTTATCGCCGAGCGCGGCCGCCAGTGGGCCGAGACGGTCCTGAGGAGGGAGGATATGCGGCTCTAT
ATGTGGCGCCTGCTGCTCGAGTGGGCGCGCGTCTGCGACGACCGGCGCCAGCTGCTCGGCTTCGTCGACGACTTG
GCGGAGGGCCGGACGGGCCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail