Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4397
Gene name
LocationContig_2241:1999..3192
Strand-
Gene length (bp)1193
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02194 PXA PXA domain 2.1E-46 41 221

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14200|PXA1_SCHPO PXA domain protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pxa1 PE=2 SV=1 50 225 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4397
LSDRATEALVRRTLCPGPSRDKARDAQPPIEELLPPLTSRNDVDLELYALLAIILREFVQGWYGNLTTDESFVAE
IVHVIAHCSRALEQRLRKVDLESLLLDELPEVLDQHVSAYRAAHRAASQPPLVVDPREAYHALRPLPALSPVPLP
GDAAAEAEQRENEAAYRQLLVQAVLAVLLPTEDLENACLTALVGQIFSELVIGNMIINKAAQPWLIFEGICILAR
NLEGKRSGAASDTRPSESGPSALPNTRIHMLQGFLASAVQLTLAVLSSIWFFFGALATSSLPPRWPSVKGTDSAC
DPDQSHELPPAAKVPILEFAAWRCAGNLIELGSRMPWLSGFLALLQFGAVRGPGHVAGPDGALDR*
Coding >Hirsu2|4397
CTGTCGGACCGCGCGACGGAGGCGCTGGTCCGGCGCACGCTCTGCCCCGGGCCGTCGCGCGACAAGGCGCGGGAC
GCGCAGCCGCCGATCGAAGAGCTGCTGCCGCCGCTGACGAGTCGCAACGACGTCGACCTCGAGCTCTATGCCCTG
CTCGCCATCATCCTGCGCGAGTTCGTGCAGGGCTGGTACGGCAACCTGACGACAGACGAGTCCTTTGTCGCCGAG
ATCGTCCACGTCATCGCCCACTGCTCGCGCGCCCTGGAGCAGCGCCTCCGCAAGGTCGACCTCGAGAGCCTGCTC
CTCGACGAGCTGCCGGAGGTGCTCGACCAGCACGTCTCAGCATACCGCGCAGCCCACCGGGCCGCCTCGCAGCCG
CCGCTTGTCGTCGACCCGCGCGAGGCCTACCACGCCCTCCGGCCGCTGCCGGCTCTGTCGCCCGTGCCTCTGCCC
GGCGACGCGGCTGCGGAGGCGGAGCAGCGGGAGAACGAGGCCGCGTACCGCCAGCTTCTCGTCCAGGCTGTCCTG
GCCGTCCTGCTGCCGACCGAGGACCTGGAGAACGCGTGCCTGACGGCGCTCGTCGGCCAGATCTTTTCCGAACTC
GTCATCGGCAACATGATCATCAACAAGGCGGCCCAGCCGTGGCTGATCTTCGAAGGCATATGCATCCTCGCCCGC
AACCTAGAAGGGAAGAGATCTGGCGCGGCTTCGGACACCAGACCATCTGAGTCTGGGCCTTCGGCACTCCCGAAC
ACACGCATCCATATGCTCCAAGGATTCCTGGCATCGGCGGTCCAGCTCACGCTGGCCGTCCTCTCATCCATCTGG
TTCTTTTTCGGGGCGCTGGCCACGTCTTCGCTGCCGCCGAGATGGCCGTCCGTCAAGGGCACGGACTCGGCTTGC
GACCCGGACCAGAGCCACGAGCTGCCGCCAGCAGCCAAGGTTCCCATTTTGGAGTTTGCCGCATGGCGCTGCGCG
GGAAACCTGATCGAGTTGGGGTCGAGGATGCCGTGGCTGAGCGGCTTCCTCGCCCTGCTGCAGTTCGGCGCAGTC
CGCGGTCCGGGACATGTCGCTGGTCCGGACGGCGCACTTGATAGGTGA
Transcript >Hirsu2|4397
CTGTCGGACCGCGCGACGGAGGCGCTGGTCCGGCGCACGCTCTGCCCCGGGCCGTCGCGCGACAAGGCGCGGGAC
GCGCAGCCGCCGATCGAAGAGCTGCTGCCGCCGCTGACGAGTCGCAACGACGTCGACCTCGAGCTCTATGCCCTG
CTCGCCATCATCCTGCGCGAGTTCGTGCAGGGCTGGTACGGCAACCTGACGACAGACGAGTCCTTTGTCGCCGAG
ATCGTCCACGTCATCGCCCACTGCTCGCGCGCCCTGGAGCAGCGCCTCCGCAAGGTCGACCTCGAGAGCCTGCTC
CTCGACGAGCTGCCGGAGGTGCTCGACCAGCACGTCTCAGCATACCGCGCAGCCCACCGGGCCGCCTCGCAGCCG
CCGCTTGTCGTCGACCCGCGCGAGGCCTACCACGCCCTCCGGCCGCTGCCGGCTCTGTCGCCCGTGCCTCTGCCC
GGCGACGCGGCTGCGGAGGCGGAGCAGCGGGAGAACGAGGCCGCGTACCGCCAGCTTCTCGTCCAGGCTGTCCTG
GCCGTCCTGCTGCCGACCGAGGACCTGGAGAACGCGTGCCTGACGGCGCTCGTCGGCCAGATCTTTTCCGAACTC
GTCATCGGCAACATGATCATCAACAAGGCGGCCCAGCCGTGGCTGATCTTCGAAGGCATATGCATCCTCGCCCGC
AACCTAGAAGGGAAGAGATCTGGCGCGGCTTCGGACACCAGACCATCTGAGTCTGGGCCTTCGGCACTCCCGAAC
ACACGCATCCATATGCTCCAAGGATTCCTGGCATCGGCGGTCCAGCTCACGCTGGCCGTCCTCTCATCCATCTGG
TTCTTTTTCGGGGCGCTGGCCACGTCTTCGCTGCCGCCGAGATGGCCGTCCGTCAAGGGCACGGACTCGGCTTGC
GACCCGGACCAGAGCCACGAGCTGCCGCCAGCAGCCAAGGTTCCCATTTTGGAGTTTGCCGCATGGCGCTGCGCG
GGAAACCTGATCGAGTTGGGGTCGAGGATGCCGTGGCTGAGCGGCTTCCTCGCCCTGCTGCAGTTCGGCGCAGTC
CGCGGTCCGGGACATGTCGCTGGTCCGGACGGCGCACTTGATAGGTGA
Gene >Hirsu2|4397
CTGTCGGACCGCGCGACGGAGGCGCTGGTCCGGCGCACGCTCTGCCCCGGGCCGTCGCGCGACAAGGCGCGGGAC
GCGCAGCCGCCGATCGAAGAGCTGCTGCCGCCGCTGACGAGTCGCAACGACGTCGACCTCGAGCTCTATGCCCTG
CTCGCCATCATCCTGCGCGAGTTCGTGCAGGGCTGGTACGGCAACCTGACGACAGACGAGTCCTTTGTCGCCGAG
ATCGTCCACGTCATCGCCCACTGCTCGCGCGCCCTGGAGCAGCGCCTCCGCAAGGTCGACCTCGAGAGCCTGCTC
CTCGACGAGCTGCCGGAGGTGCTCGACCAGCACGTCTCAGGTTGGTGATCCCCTCCAATATCCTGGCTCTTGTTT
TCCCTTCCCTCATTTCCATCGTGTCCTTGGCCTAATCGCGATGGAGGGGGGCGGGGAAAGCATACCGCGCAGCCC
ACCGGGCCGCCTCGCAGCCGCCGCTTGTCGTCGACCCGCGCGAGGCCTACCACGCCCTCCGGCCGCTGCCGGCTC
TGTCGCCCGTGCCTCTGCCCGGCGACGCGGCTGCGGAGGCGGAGCAGCGGGAGAACGAGGCCGCGTACCGCCAGC
TTCTCGTCCAGGCTGTCCTGGCCGTCCTGCTGCCGACCGAGGACCTGGAGAACGCGTGCCTGACGGCGCTCGTCG
GCCAGATCTTTTCCGAACTCGTCATCGGCAACATGATCATCAACAAGGCGGCCCAGCCGTGGCTGATCTTCGAAG
GCATATGCATCCTCGCCCGCAACCTAGAAGGGAAGAGATCTGGCGCGGCTTCGGACACCAGACCATCTGAGTCTG
GGCCTTCGGCACTCCCGAACACACGCATCCATATGCTCCAAGGATTCCTGGCATCGGCGGTCCAGCTCACGCTGG
CCGTCCTCTCATCCATCTGGTTCTTTTTCGGGGCGCTGGCCACGTCTTCGCTGCCGCCGAGATGGCCGTCCGTCA
AGGGCACGGACTCGGCTTGCGACCCGGACCAGAGCCACGAGCTGCCGCCAGCAGCCAAGGTTCCCATTTTGGAGT
TTGCCGCATGGCGCTGCGCGGGAAACCTGATCGAGTTGGGGTCGAGGATGCCGTGGCTGAGCGGCTTCCTCGCCC
TGCTGCAGTTCGGCGCAGTCCGCGGTCCGGGACATGTCGCTGGTCCGGACGGCGCACTTGATAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail