Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4395
Gene name
LocationContig_2240:2339..3167
Strand-
Gene length (bp)828
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00534 Glycos_transf_1 Glycosyl transferases group 1 3.3E-27 3 131
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 3.5E-23 3 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 1 266 2.0E-102
sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 2 255 1.0E-79
sp|B5VSZ6|GPI3_YEAS6 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SPT14 PE=3 SV=2 2 255 1.0E-79
sp|B3LKQ3|GPI3_YEAS1 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SPT14 PE=3 SV=1 2 255 1.0E-79
sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 2 255 2.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 1 266 2.0E-102
sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 2 255 1.0E-79
sp|B5VSZ6|GPI3_YEAS6 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SPT14 PE=3 SV=2 2 255 1.0E-79
sp|B3LKQ3|GPI3_YEAS1 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SPT14 PE=3 SV=1 2 255 1.0E-79
sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 2 255 2.0E-79
sp|Q64323|PIGA_MOUSE N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein OS=Mus musculus GN=Piga PE=2 SV=1 1 264 1.0E-57
sp|P37287|PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens GN=PIGA PE=1 SV=1 2 248 6.0E-57
sp|Q59002|Y1607_METJA Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1607 PE=3 SV=1 4 173 2.0E-15
sp|P42982|BSHA_BACSU N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus subtilis (strain 168) GN=bshA PE=1 SV=2 25 173 8.0E-10
sp|Q4H4F8|BTRM_BACCI 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Bacillus circulans GN=btrM PE=3 SV=1 3 129 1.0E-09
sp|P9WMY9|GLGSY_MYCTU Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3032 PE=1 SV=1 4 135 2.0E-09
sp|P9WMY8|GLGSY_MYCTO Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3116 PE=3 SV=1 4 135 2.0E-09
sp|Q8NNK8|PIMB_CORGL GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pimB PE=1 SV=1 8 116 4.0E-09
sp|Q65CC7|KANE_STRKN Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus GN=kanE PE=1 SV=1 4 132 7.0E-09
sp|Q81ST7|BSHA_BACAN N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus anthracis GN=bshA PE=1 SV=1 32 173 1.0E-08
sp|P71243|WCAL_ECOLI Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) GN=wcaL PE=3 SV=2 2 129 3.0E-08
sp|Q8S4F6|SQD2_ARATH Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana GN=SQD2 PE=1 SV=1 4 117 1.0E-07
sp|P26388|WCAL_SALTY Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wcaL PE=3 SV=1 2 135 2.0E-07
sp|O32272|TUAC_BACSU Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) GN=tuaC PE=2 SV=1 5 177 2.0E-07
sp|A0R043|PIMB_MYCS2 GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pimB PE=1 SV=1 4 116 2.0E-07
sp|Q8FSH1|MSHA_COREF D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=mshA PE=3 SV=1 4 184 3.0E-07
sp|Q46638|AMSK_ERWAM Amylovoran biosynthesis glycosyltransferase AmsK OS=Erwinia amylovora GN=amsK PE=3 SV=2 2 135 3.0E-07
sp|B1MHQ0|MSHA_MYCA9 D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=mshA PE=3 SV=1 4 166 3.0E-07
sp|Q9L1I4|Y2592_STRCO Exopolysaccharide phosphotransferase SCO2592 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2592 PE=3 SV=1 3 119 4.0E-07
sp|A0QWG6|PIMA_MYCS2 GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pimA PE=1 SV=1 14 179 4.0E-07
sp|A7TZT2|MFPS_AGRFC Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mfpsA PE=1 SV=1 4 177 7.0E-07
sp|Q4JSW2|MSHA_CORJK D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=mshA PE=3 SV=1 4 113 1.0E-06
sp|P9WMZ3|PIMB_MYCTU GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pimB PE=1 SV=1 3 123 1.0E-06
sp|P9WMZ2|PIMB_MYCTO GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pimB PE=3 SV=1 3 123 1.0E-06
sp|A0QQZ8|MSHA_MYCS2 D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mshA PE=1 SV=1 4 113 2.0E-06
sp|Q53U18|NEOD_STRFR 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Streptomyces fradiae GN=neoD PE=1 SV=1 7 140 3.0E-06
sp|C7MSY6|MSHA_SACVD D-inositol 3-phosphate glycosyltransferase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) GN=mshA PE=3 SV=1 2 162 5.0E-06
sp|D6Z995|MSHA_SEGRD D-inositol 3-phosphate glycosyltransferase OS=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) GN=mshA PE=3 SV=1 4 113 6.0E-06
sp|A5GKI7|GLGA_SYNPW Glycogen synthase OS=Synechococcus sp. (strain WH7803) GN=glgA PE=3 SV=1 6 178 6.0E-06
sp|A0PVZ1|MSHA_MYCUA D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=mshA PE=3 SV=1 4 113 7.0E-06
sp|A4FQ08|MSHA_SACEN D-inositol 3-phosphate glycosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=mshA PE=3 SV=1 2 113 7.0E-06
sp|B2HQV2|MSHA_MYCMM D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=mshA PE=3 SV=1 4 113 1.0E-05
sp|A3PU84|MSHA_MYCSJ D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium sp. (strain JLS) GN=mshA PE=3 SV=1 4 113 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 212 234 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4395
MITIVVISRLFYNKGTDLLTAAIPRILENHPNTRFIIAGSGPKAIDLEQMIETNVLQDRVEMLGPIRHEDVRDVM
VRGHIYLHPSLTEAFGTVIVEAASCGLYVVCTQVGGIPEVLPSHMTAFAKPEEDDLVLAAGRAITAVRAGQVRTD
RFHDQVRKMYSWANVALRTERVYDGVTGAIPERAFYGLDTAGGPSRARGFALIDRLKRYYGCGIWAGKLFCLCVV
IDYLFFLLLEWCQPRDAIDLCPDWPRKTLAPAPDKKASAAKPDPPPPPAL*
Coding >Hirsu2|4395
ATGATCACCATCGTCGTCATCTCGCGGCTCTTCTACAACAAGGGGACGGACCTGCTGACGGCGGCGATACCGCGG
ATCCTGGAGAACCACCCGAACACGCGCTTCATCATCGCCGGCTCGGGCCCCAAGGCCATCGACCTGGAGCAGATG
ATTGAGACCAACGTGCTGCAGGACCGGGTCGAGATGCTGGGCCCGATCCGGCACGAGGACGTGCGCGACGTCATG
GTGCGCGGCCACATCTACCTGCACCCGTCGCTGACGGAGGCCTTCGGGACCGTCATCGTCGAGGCCGCCAGCTGC
GGCCTCTACGTCGTCTGCACCCAGGTCGGCGGCATCCCCGAGGTGCTGCCGTCGCACATGACGGCCTTCGCCAAG
CCCGAGGAGGACGACCTGGTGCTGGCGGCGGGGCGGGCCATCACGGCCGTCCGCGCCGGCCAGGTCCGCACCGAC
CGCTTCCACGACCAGGTCCGCAAGATGTACTCGTGGGCCAACGTCGCCCTGCGCACCGAGCGCGTCTACGACGGC
GTCACCGGCGCCATCCCCGAGCGCGCCTTCTACGGCCTCGACACCGCTGGCGGGCCCAGCCGCGCCCGCGGCTTC
GCCCTCATCGACCGCCTCAAGCGCTACTACGGCTGCGGCATCTGGGCCGGCAAGCTCTTCTGCCTCTGCGTCGTC
ATCGACTACCTCTTCTTCCTCCTGCTCGAGTGGTGCCAGCCCCGCGACGCCATCGACCTCTGCCCGGACTGGCCG
CGCAAGACGCTCGCCCCGGCCCCCGACAAGAAGGCCTCCGCCGCCAAGCCGGACCCGCCCCCGCCCCCGGCCCTC
TGA
Transcript >Hirsu2|4395
ATGATCACCATCGTCGTCATCTCGCGGCTCTTCTACAACAAGGGGACGGACCTGCTGACGGCGGCGATACCGCGG
ATCCTGGAGAACCACCCGAACACGCGCTTCATCATCGCCGGCTCGGGCCCCAAGGCCATCGACCTGGAGCAGATG
ATTGAGACCAACGTGCTGCAGGACCGGGTCGAGATGCTGGGCCCGATCCGGCACGAGGACGTGCGCGACGTCATG
GTGCGCGGCCACATCTACCTGCACCCGTCGCTGACGGAGGCCTTCGGGACCGTCATCGTCGAGGCCGCCAGCTGC
GGCCTCTACGTCGTCTGCACCCAGGTCGGCGGCATCCCCGAGGTGCTGCCGTCGCACATGACGGCCTTCGCCAAG
CCCGAGGAGGACGACCTGGTGCTGGCGGCGGGGCGGGCCATCACGGCCGTCCGCGCCGGCCAGGTCCGCACCGAC
CGCTTCCACGACCAGGTCCGCAAGATGTACTCGTGGGCCAACGTCGCCCTGCGCACCGAGCGCGTCTACGACGGC
GTCACCGGCGCCATCCCCGAGCGCGCCTTCTACGGCCTCGACACCGCTGGCGGGCCCAGCCGCGCCCGCGGCTTC
GCCCTCATCGACCGCCTCAAGCGCTACTACGGCTGCGGCATCTGGGCCGGCAAGCTCTTCTGCCTCTGCGTCGTC
ATCGACTACCTCTTCTTCCTCCTGCTCGAGTGGTGCCAGCCCCGCGACGCCATCGACCTCTGCCCGGACTGGCCG
CGCAAGACGCTCGCCCCGGCCCCCGACAAGAAGGCCTCCGCCGCCAAGCCGGACCCGCCCCCGCCCCCGGCCCTC
TGA
Gene >Hirsu2|4395
ATGATCACCATCGTCGTCATCTCGCGGCTCTTCTACAACAAGGGGACGGACCTGCTGACGGCGGCGATACCGCGG
ATCCTGGAGAACCACCCGAACACGCGCTTCATCATCGCCGGCTCGGGCCCCAAGGCCATCGACCTGGAGCAGATG
ATTGAGACCAACGTGCTGCAGGACCGGGTCGAGATGCTGGGCCCGATCCGGCACGAGGACGTGCGCGACGTCATG
GTGCGCGGCCACATCTACCTGCACCCGTCGCTGACGGAGGCCTTCGGGACCGTCATCGTCGAGGCCGCCAGCTGC
GGCCTCTACGTCGTCTGCACCCAGGTCGGCGGCATCCCCGAGGTGCTGCCGTCGCACATGACGGCCTTCGCCAAG
CCCGAGGAGGACGACCTGGTGCTGGCGGCGGGGCGGGCCATCACGGCCGTCCGCGCCGGCCAGGTCCGCACCGAC
CGCTTCCACGACCAGGTCCGCAAGATGTACTCGTGGGCCAACGTCGCCCTGCGCACCGAGCGCGTCTACGACGGC
GTCACCGGCGCCATCCCCGAGCGCGCCTTCTACGGCCTCGACACCGCTGGCGGGCCCAGCCGCGCCCGCGGCTTC
GCCCTCATCGACCGCCTCAAGCGCTACTACGGCTGCGGCATCTGGGCCGGCAAGCTCTTCTGCCTCTGCGTCGTC
ATCGACTACCTCTTCTTCCTCCTGCTCGAGTGGTGCCAGCCCCGCGACGCCATCGACCTCTGCCCGGACTGGCCG
CGCAAGACGCTCGCCCCGGCCCCCGACAAGAAGGCCTCCGCCGCCAAGCCGGACCCGCCCCCGCCCCCGGCCCTC
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail