Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4383
Gene name
LocationContig_2235:1095..2420
Strand+
Gene length (bp)1325
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05920 Homeobox_KN Homeobox KN domain 3.8E-21 280 319
PF00046 Homeodomain Homeodomain 2.2E-08 263 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HJ84|PKNX1_BOVIN Homeobox protein PKNOX1 OS=Bos taurus GN=PKNOX1 PE=2 SV=1 259 332 4.0E-18
sp|O70477|PKNX1_MOUSE Homeobox protein PKNOX1 OS=Mus musculus GN=Pknox1 PE=1 SV=3 259 332 5.0E-18
sp|P55347|PKNX1_HUMAN Homeobox protein PKNOX1 OS=Homo sapiens GN=PKNOX1 PE=1 SV=3 259 332 5.0E-18
sp|Q8C0Y1|TGIF2_MOUSE Homeobox protein TGIF2 OS=Mus musculus GN=Tgif2 PE=2 SV=1 248 345 9.0E-18
sp|O46339|HTH_DROME Homeobox protein homothorax OS=Drosophila melanogaster GN=hth PE=1 SV=1 250 329 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HJ84|PKNX1_BOVIN Homeobox protein PKNOX1 OS=Bos taurus GN=PKNOX1 PE=2 SV=1 259 332 4.0E-18
sp|O70477|PKNX1_MOUSE Homeobox protein PKNOX1 OS=Mus musculus GN=Pknox1 PE=1 SV=3 259 332 5.0E-18
sp|P55347|PKNX1_HUMAN Homeobox protein PKNOX1 OS=Homo sapiens GN=PKNOX1 PE=1 SV=3 259 332 5.0E-18
sp|Q8C0Y1|TGIF2_MOUSE Homeobox protein TGIF2 OS=Mus musculus GN=Tgif2 PE=2 SV=1 248 345 9.0E-18
sp|O46339|HTH_DROME Homeobox protein homothorax OS=Drosophila melanogaster GN=hth PE=1 SV=1 250 329 1.0E-17
sp|Q9GZN2|TGIF2_HUMAN Homeobox protein TGIF2 OS=Homo sapiens GN=TGIF2 PE=1 SV=1 248 345 1.0E-17
sp|Q96KN3|PKNX2_HUMAN Homeobox protein PKNOX2 OS=Homo sapiens GN=PKNOX2 PE=2 SV=2 259 326 2.0E-17
sp|Q8BG99|PKNX2_MOUSE Homeobox protein PKNOX2 OS=Mus musculus GN=Pknox2 PE=2 SV=1 259 326 2.0E-17
sp|Q5R6L1|PKNX2_PONAB Homeobox protein PKNOX2 OS=Pongo abelii GN=PKNOX2 PE=2 SV=1 259 326 3.0E-17
sp|Q86IH1|HBX4_DICDI Homeobox protein 4 OS=Dictyostelium discoideum GN=hbx4 PE=3 SV=1 253 339 7.0E-17
sp|A8K0S8|ME3L2_HUMAN Putative homeobox protein Meis3-like 2 OS=Homo sapiens GN=MEIS3P2 PE=2 SV=1 250 328 8.0E-17
sp|A6NDR6|ME3L1_HUMAN Putative homeobox protein Meis3-like 1 OS=Homo sapiens GN=MEIS3P1 PE=5 SV=2 250 328 1.0E-16
sp|Q99687|MEIS3_HUMAN Homeobox protein Meis3 OS=Homo sapiens GN=MEIS3 PE=2 SV=3 250 328 2.0E-16
sp|P97368|MEIS3_MOUSE Homeobox protein Meis3 OS=Mus musculus GN=Meis3 PE=2 SV=2 255 328 3.0E-16
sp|A1YGI6|TF2LX_PANPA Homeobox protein TGIF2LX OS=Pan paniscus GN=TGIF2LX PE=3 SV=1 249 353 3.0E-16
sp|Q90655|AKR_CHICK Homeobox protein AKR OS=Gallus gallus PE=2 SV=1 262 358 6.0E-16
sp|Q6DIF3|MEIS3_XENTR Homeobox protein meis3 OS=Xenopus tropicalis GN=meis3 PE=2 SV=2 263 329 7.0E-16
sp|Q5U4X3|MEI3A_XENLA Homeobox protein meis3-A OS=Xenopus laevis GN=meis3-a PE=2 SV=1 263 329 7.0E-16
sp|Q7ZY13|MEI3B_XENLA Homeobox protein meis3-B OS=Xenopus laevis GN=meis3-b PE=2 SV=2 263 329 8.0E-16
sp|Q8MIB7|TF2LX_PANTR Homeobox protein TGIF2LX OS=Pan troglodytes GN=TGIF2LX PE=2 SV=2 249 329 8.0E-16
sp|Q8IUE1|TF2LX_HUMAN Homeobox protein TGIF2LX OS=Homo sapiens GN=TGIF2LX PE=1 SV=1 249 329 8.0E-16
sp|Q8MIE9|TF2LX_GORGO Homeobox protein TGIF2LX OS=Gorilla gorilla gorilla GN=TGIF2LX PE=2 SV=1 249 329 1.0E-15
sp|P41817|CUP9_YEAST Homeobox protein CUP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUP9 PE=1 SV=1 265 321 1.0E-15
sp|P56665|KNOX7_MAIZE Homeobox protein knotted-1-like 7 (Fragment) OS=Zea mays GN=KNOX7 PE=2 SV=1 255 319 2.0E-15
sp|P56664|KNOX6_MAIZE Homeobox protein knotted-1-like 6 (Fragment) OS=Zea mays GN=KNOX6 PE=2 SV=1 255 319 2.0E-15
sp|Q8IUE0|TF2LY_HUMAN Homeobox protein TGIF2LY OS=Homo sapiens GN=TGIF2LY PE=1 SV=1 249 329 2.0E-15
sp|Q54VB4|HBX9_DICDI Homeobox protein 9 OS=Dictyostelium discoideum GN=hbx9 PE=3 SV=1 258 322 3.0E-15
sp|P53147|TOS8_YEAST Homeobox protein TOS8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS8 PE=3 SV=1 253 328 5.0E-15
sp|Q8SRR1|HD12_ENCCU Homeobox protein HD-12 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-12 PE=3 SV=1 265 324 5.0E-15
sp|P79937|MEIS1_XENLA Homeobox protein Meis1 OS=Xenopus laevis GN=meis1 PE=1 SV=1 264 328 5.0E-15
sp|P70284|TGIF1_MOUSE Homeobox protein TGIF1 OS=Mus musculus GN=Tgif1 PE=1 SV=2 262 325 6.0E-15
sp|P97367|MEIS2_MOUSE Homeobox protein Meis2 OS=Mus musculus GN=Meis2 PE=1 SV=2 266 339 7.0E-15
sp|O14770|MEIS2_HUMAN Homeobox protein Meis2 OS=Homo sapiens GN=MEIS2 PE=1 SV=2 266 339 7.0E-15
sp|P56659|KNOX1_MAIZE Homeobox protein knotted-1-like 1 (Fragment) OS=Zea mays GN=KNOX1 PE=2 SV=1 255 319 8.0E-15
sp|Q60954|MEIS1_MOUSE Homeobox protein Meis1 OS=Mus musculus GN=Meis1 PE=1 SV=1 266 329 1.0E-14
sp|O00470|MEIS1_HUMAN Homeobox protein Meis1 OS=Homo sapiens GN=MEIS1 PE=1 SV=1 266 329 1.0E-14
sp|Q0J6N4|KNOSD_ORYSJ Homeobox protein knotted-1-like 13 OS=Oryza sativa subsp. japonica GN=OSH45 PE=2 SV=2 255 345 1.0E-14
sp|Q9FPQ8|KNAT7_ARATH Homeobox protein knotted-1-like 7 OS=Arabidopsis thaliana GN=KNAT7 PE=1 SV=1 255 338 1.0E-14
sp|P56660|KNOX2_MAIZE Homeobox protein knotted-1-like 2 (Fragment) OS=Zea mays GN=KNOX2 PE=2 SV=1 255 319 1.0E-14
sp|P46606|HD1_BRANA Homeobox protein HD1 OS=Brassica napus GN=HD1 PE=2 SV=1 255 338 2.0E-14
sp|Q0E3C3|KNOS2_ORYSJ Homeobox protein knotted-1-like 2 OS=Oryza sativa subsp. japonica GN=HOS58 PE=2 SV=2 255 319 2.0E-14
sp|Q5IS58|TGIF1_PANTR Homeobox protein TGIF1 OS=Pan troglodytes GN=TGIF1 PE=2 SV=1 262 325 2.0E-14
sp|Q15583|TGIF1_HUMAN Homeobox protein TGIF1 OS=Homo sapiens GN=TGIF1 PE=1 SV=3 262 325 3.0E-14
sp|P48000|KNAT3_ARATH Homeobox protein knotted-1-like 3 OS=Arabidopsis thaliana GN=KNAT3 PE=1 SV=1 255 343 5.0E-14
sp|Q8MID1|TF2LX_MIOTA Homeobox protein TGIF2LX OS=Miopithecus talapoin GN=TGIF2LX PE=2 SV=1 249 325 5.0E-14
sp|Q8MIC2|TF2LX_PAPHA Homeobox protein TGIF2LX OS=Papio hamadryas GN=TGIF2LX PE=2 SV=1 249 325 6.0E-14
sp|Q8MID8|TF2LX_MACFA Homeobox protein TGIF2LX OS=Macaca fascicularis GN=TGIF2LX PE=2 SV=1 262 325 6.0E-14
sp|Q8MIB8|TF2LX_PONPY Homeobox protein TGIF2LX OS=Pongo pygmaeus GN=TGIF2LX PE=2 SV=1 262 328 6.0E-14
sp|Q94LW3|KNOS3_ORYSJ Homeobox protein knotted-1-like 3 OS=Oryza sativa subsp. japonica GN=HOS66 PE=2 SV=1 255 332 9.0E-14
sp|A8WL06|UNC62_CAEBR Homeobox protein unc-62 OS=Caenorhabditis briggsae GN=unc-62 PE=3 SV=2 257 336 1.0E-13
sp|O04136|KNAP3_MALDO Homeobox protein knotted-1-like 3 OS=Malus domestica PE=2 SV=1 255 319 1.0E-13
sp|Q94LW4|KNOSB_ORYSJ Homeobox protein knotted-1-like 11 OS=Oryza sativa subsp. japonica GN=HOS59 PE=2 SV=2 255 319 2.0E-13
sp|Q9N5D6|UNC62_CAEEL Homeobox protein unc-62 OS=Caenorhabditis elegans GN=unc-62 PE=1 SV=1 257 330 2.0E-13
sp|Q8MIE6|TF2LX_HYLLA Homeobox protein TGIF2LX OS=Hylobates lar GN=TGIF2LX PE=2 SV=1 263 325 2.0E-13
sp|P48002|KNAT5_ARATH Homeobox protein knotted-1-like 5 OS=Arabidopsis thaliana GN=KNAT5 PE=1 SV=2 243 319 2.0E-13
sp|O22300|LET12_SOLLC Homeobox protein knotted-1-like LET12 OS=Solanum lycopersicum GN=LET12 PE=2 SV=1 255 319 2.0E-13
sp|Q9SJJ3|BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana GN=BLH8 PE=1 SV=1 253 325 2.0E-13
sp|P48001|KNAT4_ARATH Homeobox protein knotted-1-like 4 OS=Arabidopsis thaliana GN=KNAT4 PE=1 SV=3 255 343 3.0E-13
sp|Q8MID6|TF2LX_MACMU Homeobox protein TGIF2LX OS=Macaca mulatta GN=TGIF2LX PE=2 SV=1 262 325 5.0E-13
sp|Q9FXG8|BLH10_ARATH BEL1-like homeodomain protein 10 OS=Arabidopsis thaliana GN=BLH10 PE=1 SV=1 263 331 3.0E-12
sp|Q9SW80|BLH2_ARATH BEL1-like homeodomain protein 2 OS=Arabidopsis thaliana GN=BLH2 PE=1 SV=3 263 325 4.0E-12
sp|Q8SR09|HD2_ENCCU Homeobox protein HD-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-2 PE=3 SV=1 266 324 5.0E-12
sp|Q9FWS9|BLH3_ARATH BEL1-like homeodomain protein 3 OS=Arabidopsis thaliana GN=BLH3 PE=1 SV=1 263 331 5.0E-12
sp|Q1PFD1|BLH11_ARATH BEL1-like homeodomain protein 11 OS=Arabidopsis thaliana GN=BLH11 PE=2 SV=1 269 325 6.0E-12
sp|Q9LZM8|BLH9_ARATH BEL1-like homeodomain protein 9 OS=Arabidopsis thaliana GN=BLH9 PE=1 SV=1 263 325 7.0E-12
sp|Q10ED2|KNOS8_ORYSJ Homeobox protein knotted-1-like 8 OS=Oryza sativa subsp. japonica GN=OSH43 PE=2 SV=1 246 319 8.0E-12
sp|Q38897|BEL1_ARATH Homeobox protein BEL1 homolog OS=Arabidopsis thaliana GN=BEL1 PE=1 SV=2 263 331 3.0E-11
sp|Q94KL5|BLH4_ARATH BEL1-like homeodomain protein 4 OS=Arabidopsis thaliana GN=BLH4 PE=1 SV=2 263 325 3.0E-11
sp|P56667|KNX10_MAIZE Homeobox protein knotted-1-like 10 (Fragment) OS=Zea mays GN=KNOX10 PE=3 SV=1 262 320 6.0E-11
sp|Q99NE9|PBX4_MOUSE Pre-B-cell leukemia transcription factor 4 OS=Mus musculus GN=Pbx4 PE=2 SV=2 263 319 1.0E-10
sp|Q10EC6|KNOS9_ORYSJ Homeobox protein knotted-1-like 9 OS=Oryza sativa subsp. japonica GN=Os03g0772100 PE=3 SV=2 246 319 1.0E-10
sp|Q9BYU1|PBX4_HUMAN Pre-B-cell leukemia transcription factor 4 OS=Homo sapiens GN=PBX4 PE=1 SV=2 263 319 2.0E-10
sp|O65685|BLH6_ARATH BEL1-like homeodomain protein 6 OS=Arabidopsis thaliana GN=BLH6 PE=1 SV=1 263 331 2.0E-10
sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidopsis thaliana GN=BLH1 PE=1 SV=1 263 319 2.0E-10
sp|Q9SIW1|BLH7_ARATH BEL1-like homeodomain protein 7 OS=Arabidopsis thaliana GN=BLH7 PE=2 SV=1 263 325 3.0E-10
sp|O35984|PBX2_MOUSE Pre-B-cell leukemia transcription factor 2 OS=Mus musculus GN=Pbx2 PE=1 SV=1 263 319 4.0E-10
sp|P40425|PBX2_HUMAN Pre-B-cell leukemia transcription factor 2 OS=Homo sapiens GN=PBX2 PE=1 SV=2 263 319 4.0E-10
sp|B3DM47|PBX2_XENTR Pre-B-cell leukemia transcription factor 2 OS=Xenopus tropicalis GN=pbx2 PE=2 SV=1 263 319 6.0E-10
sp|Q8S897|BLH5_ARATH BEL1-like homeodomain protein 5 OS=Arabidopsis thaliana GN=BLH5 PE=1 SV=2 263 340 6.0E-10
sp|P41778|PBX1_MOUSE Pre-B-cell leukemia transcription factor 1 OS=Mus musculus GN=Pbx1 PE=1 SV=2 263 319 8.0E-10
sp|P40424|PBX1_HUMAN Pre-B-cell leukemia transcription factor 1 OS=Homo sapiens GN=PBX1 PE=1 SV=1 263 319 8.0E-10
sp|Q7PMT1|EXD_ANOGA Homeobox protein extradenticle OS=Anopheles gambiae GN=exd PE=3 SV=2 263 319 9.0E-10
sp|P40427|EXD_DROME Homeobox protein extradenticle OS=Drosophila melanogaster GN=exd PE=1 SV=1 263 319 9.0E-10
sp|Q29CT2|EXD_DROPS Homeobox protein extradenticle OS=Drosophila pseudoobscura pseudoobscura GN=exd PE=3 SV=1 263 319 1.0E-09
sp|Q9QY61|IRX4_MOUSE Iroquois-class homeodomain protein IRX-4 OS=Mus musculus GN=Irx4 PE=2 SV=1 237 319 1.0E-09
sp|P48731|ATH1_ARATH Homeobox protein ATH1 OS=Arabidopsis thaliana GN=ATH1 PE=1 SV=1 243 338 2.0E-09
sp|P41779|HM20_CAEEL Homeobox protein ceh-20 OS=Caenorhabditis elegans GN=ceh-20 PE=1 SV=1 263 333 2.0E-09
sp|Q9YGS0|IRX4_CHICK Iroquois-class homeodomain protein IRX-4 OS=Gallus gallus GN=IRX4 PE=2 SV=1 234 319 2.0E-09
sp|B4F6V6|PBX1_XENTR Pre-B-cell leukemia transcription factor 1 OS=Xenopus tropicalis GN=pbx1 PE=2 SV=1 263 345 3.0E-09
sp|Q8QGC4|PBX1_XENLA Pre-B-cell leukemia transcription factor 1 OS=Xenopus laevis GN=pbx1 PE=1 SV=1 263 345 3.0E-09
sp|P78412|IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 OS=Homo sapiens GN=IRX6 PE=2 SV=3 265 319 3.0E-09
sp|Q75LX9|KNOS5_ORYSJ Putative homeobox protein knotted-1-like 5 OS=Oryza sativa subsp. japonica GN=Os03g0673500 PE=3 SV=1 261 319 3.0E-09
sp|Q9ER75|IRX6_MOUSE Iroquois-class homeodomain protein IRX-6 OS=Mus musculus GN=Irx6 PE=2 SV=2 240 319 3.0E-09
sp|P78413|IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 OS=Homo sapiens GN=IRX4 PE=1 SV=2 249 319 3.0E-09
sp|O35317|PBX3_MOUSE Pre-B-cell leukemia transcription factor 3 OS=Mus musculus GN=Pbx3 PE=2 SV=1 263 319 5.0E-09
sp|P40426|PBX3_HUMAN Pre-B-cell leukemia transcription factor 3 OS=Homo sapiens GN=PBX3 PE=1 SV=1 263 319 5.0E-09
sp|Q19503|HM40_CAEEL Homeobox protein ceh-40 OS=Caenorhabditis elegans GN=ceh-40 PE=1 SV=1 263 327 6.0E-09
sp|Q6IR52|PBX2_XENLA Pre-B-cell leukemia transcription factor 2 OS=Xenopus laevis GN=pbx2 PE=2 SV=1 263 319 8.0E-09
sp|P54269|CAUP_DROME Homeobox protein caupolican OS=Drosophila melanogaster GN=caup PE=2 SV=2 265 319 9.0E-09
sp|Q688D0|IRX4_XENTR Iroquois-class homeodomain protein irx-4 OS=Xenopus tropicalis GN=irx4 PE=2 SV=1 242 319 9.0E-09
sp|Q90XW6|IRX4A_XENLA Iroquois-class homeodomain protein irx-4-A OS=Xenopus laevis GN=irx4-a PE=2 SV=1 242 319 9.0E-09
sp|Q6F2E3|IRX1_XENTR Iroquois-class homeodomain protein irx-1 OS=Xenopus tropicalis GN=irx1 PE=2 SV=1 191 319 9.0E-09
sp|B7ZRT8|IRX4B_XENLA Iroquois-class homeodomain protein irx-4-B OS=Xenopus laevis GN=irx4-b PE=2 SV=1 242 319 1.0E-08
sp|Q9YGK8|IRX1A_XENLA Iroquois-class homeodomain protein irx-1-A OS=Xenopus laevis GN=irx1-a PE=2 SV=1 191 319 1.0E-08
sp|Q2TAQ8|IRX1B_XENLA Iroquois-class homeodomain protein irx-1-B OS=Xenopus laevis GN=irx1-b PE=2 SV=1 191 319 2.0E-08
sp|Q24248|ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster GN=ara PE=1 SV=2 265 319 3.0E-08
sp|P81067|IRX3_MOUSE Iroquois-class homeodomain protein IRX-3 OS=Mus musculus GN=Irx3 PE=1 SV=2 224 319 4.0E-08
sp|P56661|KNOX3_MAIZE Homeobox protein knotted-1-like 3 (Fragment) OS=Zea mays GN=KNOX3 PE=2 SV=1 272 320 6.0E-08
sp|Q75LX7|KNOS4_ORYSJ Homeobox protein knotted-1-like 4 OS=Oryza sativa subsp. japonica GN=OSH10 PE=2 SV=1 269 319 6.0E-08
sp|P78414|IRX1_HUMAN Iroquois-class homeodomain protein IRX-1 OS=Homo sapiens GN=IRX1 PE=2 SV=3 218 319 1.0E-07
sp|P46640|KNAT2_ARATH Homeobox protein knotted-1-like 2 OS=Arabidopsis thaliana GN=KNAT2 PE=1 SV=3 269 319 1.0E-07
sp|P81066|IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 OS=Mus musculus GN=Irx2 PE=2 SV=2 266 319 1.0E-07
sp|Q84JS6|KNAT6_ARATH Homeobox protein knotted-1-like 6 OS=Arabidopsis thaliana GN=KNAT6 PE=1 SV=1 269 319 1.0E-07
sp|Q9BZI1|IRX2_HUMAN Iroquois-class homeodomain protein IRX-2 OS=Homo sapiens GN=IRX2 PE=1 SV=2 266 319 1.0E-07
sp|Q9JKQ4|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus GN=Irx5 PE=2 SV=1 258 319 2.0E-07
sp|P81068|IRX1_MOUSE Iroquois-class homeodomain protein IRX-1 OS=Mus musculus GN=Irx1 PE=1 SV=4 265 319 2.0E-07
sp|P78411|IRX5_HUMAN Iroquois-class homeodomain protein IRX-5 OS=Homo sapiens GN=IRX5 PE=1 SV=3 258 319 2.0E-07
sp|Q66IK1|IRX2_XENTR Iroquois-class homeodomain protein irx-2 OS=Xenopus tropicalis GN=irx2 PE=2 SV=1 266 319 2.0E-07
sp|P56662|KNOX4_MAIZE Homeobox protein knotted-1-like 4 (Fragment) OS=Zea mays GN=KNOX4 PE=2 SV=1 272 320 2.0E-07
sp|Q6DCQ1|IRX2_XENLA Iroquois-class homeodomain protein irx-2 OS=Xenopus laevis GN=irx2 PE=2 SV=1 266 319 2.0E-07
sp|Q6NVN3|IRX3_XENTR Iroquois-class homeodomain protein irx-3 OS=Xenopus tropicalis GN=irx3 PE=2 SV=1 265 319 3.0E-07
sp|O42261|IRX3_XENLA Iroquois-class homeodomain protein irx-3 OS=Xenopus laevis GN=irx3 PE=2 SV=2 265 319 3.0E-07
sp|P78415|IRX3_HUMAN Iroquois-class homeodomain protein IRX-3 OS=Homo sapiens GN=IRX3 PE=2 SV=3 265 319 3.0E-07
sp|P56666|KNOX8_MAIZE Homeobox protein knotted-1-like 8 (Fragment) OS=Zea mays GN=KNOX8 PE=2 SV=1 246 320 4.0E-07
sp|Q4LDQ3|IRX5_XENTR Iroquois-class homeodomain protein irx-5 OS=Xenopus tropicalis GN=irx5 PE=2 SV=1 266 319 4.0E-07
sp|Q43484|KNOX3_HORVU Homeobox protein KNOX3 OS=Hordeum vulgare GN=KNOX3 PE=1 SV=1 272 319 4.0E-07
sp|O04134|KNAP1_MALDO Homeobox protein knotted-1-like 1 OS=Malus domestica PE=2 SV=1 272 319 4.0E-07
sp|P46639|KNAT1_ARATH Homeobox protein knotted-1-like 1 OS=Arabidopsis thaliana GN=KNAT1 PE=1 SV=1 272 319 5.0E-07
sp|Q90XW5|IRX5_XENLA Iroquois-class homeodomain protein irx-5 OS=Xenopus laevis GN=irx5 PE=2 SV=1 266 319 6.0E-07
sp|P24345|KN1_MAIZE Homeotic protein knotted-1 OS=Zea mays GN=KN-1 PE=2 SV=1 272 319 7.0E-07
sp|O04135|KNAP2_MALDO Homeobox protein knotted-1-like 2 OS=Malus domestica PE=2 SV=1 276 319 7.0E-07
sp|Q41330|KN1_SOLLC Homeotic protein knotted-1 OS=Solanum lycopersicum GN=KN1 PE=2 SV=1 276 319 8.0E-07
sp|Q41853|RSH1_MAIZE Homeobox protein rough sheath 1 OS=Zea mays GN=RS1 PE=2 SV=1 272 319 8.0E-07
sp|O80416|KNOSC_ORYSJ Homeobox protein knotted-1-like 12 OS=Oryza sativa subsp. japonica GN=OSH15 PE=2 SV=1 272 319 9.0E-07
sp|O65034|KNOSC_ORYSI Homeobox protein knotted-1-like 12 OS=Oryza sativa subsp. indica GN=OSH15 PE=2 SV=2 272 319 9.0E-07
sp|O22299|LET6_SOLLC Homeobox protein knotted-1-like LET6 OS=Solanum lycopersicum GN=LET6 PE=2 SV=1 272 319 1.0E-06
sp|P56669|HLG3_MAIZE Homeobox protein liguleless 3 (Fragment) OS=Zea mays GN=LG3 PE=3 SV=1 277 320 1.0E-06
sp|P46609|KNOS6_ORYSJ Homeobox protein knotted-1-like 6 OS=Oryza sativa subsp. japonica GN=OSH1 PE=2 SV=2 276 319 2.0E-06
sp|Q7GDL5|KNOSA_ORYSJ Homeobox protein knotted-1-like 10 OS=Oryza sativa subsp. japonica GN=OSH71 PE=2 SV=1 277 320 3.0E-06
sp|A2Y007|KNOSA_ORYSI Homeobox protein knotted-1-like 10 OS=Oryza sativa subsp. indica GN=OSH71 PE=2 SV=2 277 320 3.0E-06
sp|P56663|KNOX5_MAIZE Homeobox protein knotted-1-like 5 (Fragment) OS=Zea mays GN=KNOX5 PE=2 SV=1 277 319 3.0E-06
sp|Q9FP29|KNOS1_ORYSJ Homeobox protein knotted-1-like 1 OS=Oryza sativa subsp. japonica GN=OSH6 PE=2 SV=1 277 319 3.0E-06
sp|Q93348|IRX_CAEEL Putative iroquois-class homeodomain protein irx-1 OS=Caenorhabditis elegans GN=irx-1 PE=3 SV=3 265 319 4.0E-06
sp|P56668|KNX11_MAIZE Homeobox protein knotted-1-like 11 (Fragment) OS=Zea mays GN=KNOX11 PE=3 SV=1 277 319 4.0E-06
sp|P46608|HSBH1_SOYBN Homeobox protein SBH1 OS=Glycine max GN=H1 PE=2 SV=1 272 319 6.0E-06
sp|Q9M6D9|STM_BRAOL Homeobox protein SHOOT MERISTEMLESS OS=Brassica oleracea GN=STM PE=2 SV=1 272 319 6.0E-06
sp|Q38874|STM_ARATH Homeobox protein SHOOT MERISTEMLESS OS=Arabidopsis thaliana GN=STM PE=1 SV=2 272 319 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Homeodomain

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4383
MSILTMATPPPHPLFRNDSHWDAAQPSSDCARPRTENRSIVALPSIRQTFPELHLEGSLADGPAARPFTHRSPSV
AGPGSLASPEYVHSPNTSKRRRISMEDEQLPMRSQYVPRLYRSPERPPPRQLSPPHREPPTAESWASPSRFGSSS
VTPGPIEMDGRIEPRPGLPSMPPTVAKLEREPVPMHAGRESAAGTAVLDRHPAYRAPDYGYSYHHHPSRYQSLST
SSIRPHERAAFSAGGNYHAHYQDMGRQGGDVGGDAKQRKRRGNLPKETTDKLRAWFVAHLQHPYPTEDEKQELMR
QTGLQMNQISNWFINARRRQLPAMINNARAETEVMNSRVGGAGGDGEILASTERAADFCKRGEGLPVSDGEGCAY
DEDMSGLRKRRIGDLNRESV*
Coding >Hirsu2|4383
ATGTCTATTCTTACCATGGCCACGCCACCACCGCACCCCCTGTTCAGGAACGACAGCCACTGGGATGCGGCCCAG
CCGTCTTCAGACTGCGCCCGACCGCGGACCGAGAATAGGTCGATCGTCGCCCTGCCGTCCATCCGCCAGACGTTT
CCCGAACTTCACCTCGAGGGGTCGCTAGCAGACGGGCCCGCAGCGAGGCCCTTCACCCACAGATCACCAAGTGTG
GCGGGTCCAGGGTCGCTCGCCTCACCAGAATACGTTCACTCGCCCAACACGAGCAAACGGAGGAGGATTTCGATG
GAGGACGAGCAGCTTCCGATGCGGTCTCAGTACGTGCCGAGGTTGTATCGGAGCCCCGAGCGGCCGCCTCCGCGA
CAGCTCTCGCCGCCCCATCGCGAACCGCCGACGGCCGAGAGCTGGGCGAGCCCGAGCCGGTTCGGATCCAGCAGC
GTGACCCCCGGTCCGATCGAAATGGACGGCAGAATCGAGCCACGGCCTGGGCTGCCGAGCATGCCGCCCACCGTC
GCCAAACTGGAGAGGGAGCCGGTCCCGATGCACGCAGGTCGAGAATCGGCGGCGGGGACGGCTGTGCTCGACCGG
CATCCGGCATATCGCGCGCCAGACTACGGCTATTCGTACCACCACCACCCCAGTCGTTACCAGTCGCTCTCGACG
AGCTCGATCCGACCGCACGAGCGAGCGGCCTTCTCGGCCGGGGGCAACTACCACGCGCACTACCAGGACATGGGG
AGGCAGGGAGGCGATGTCGGGGGCGACGCCAAGCAACGGAAGCGGCGAGGAAACCTGCCCAAGGAGACGACGGAC
AAACTGCGGGCCTGGTTCGTGGCACATCTTCAACACCCGTACCCGACCGAGGACGAGAAGCAGGAATTGATGCGT
CAGACGGGCCTTCAGATGAACCAAATATCAAACTGGTTCATCAACGCGCGGCGGAGGCAGCTGCCGGCCATGATC
AACAACGCCAGGGCGGAGACAGAGGTGATGAACAGCCGGGTGGGCGGCGCCGGCGGGGACGGCGAGATCCTAGCA
TCGACGGAGCGAGCTGCCGACTTTTGCAAGCGTGGGGAAGGGTTGCCGGTCAGCGACGGCGAGGGGTGCGCCTAC
GACGAGGACATGAGCGGTCTACGGAAGCGTCGAATCGGCGATCTCAACCGGGAGAGCGTCTGA
Transcript >Hirsu2|4383
ATGTCTATTCTTACCATGGCCACGCCACCACCGCACCCCCTGTTCAGGAACGACAGCCACTGGGATGCGGCCCAG
CCGTCTTCAGACTGCGCCCGACCGCGGACCGAGAATAGGTCGATCGTCGCCCTGCCGTCCATCCGCCAGACGTTT
CCCGAACTTCACCTCGAGGGGTCGCTAGCAGACGGGCCCGCAGCGAGGCCCTTCACCCACAGATCACCAAGTGTG
GCGGGTCCAGGGTCGCTCGCCTCACCAGAATACGTTCACTCGCCCAACACGAGCAAACGGAGGAGGATTTCGATG
GAGGACGAGCAGCTTCCGATGCGGTCTCAGTACGTGCCGAGGTTGTATCGGAGCCCCGAGCGGCCGCCTCCGCGA
CAGCTCTCGCCGCCCCATCGCGAACCGCCGACGGCCGAGAGCTGGGCGAGCCCGAGCCGGTTCGGATCCAGCAGC
GTGACCCCCGGTCCGATCGAAATGGACGGCAGAATCGAGCCACGGCCTGGGCTGCCGAGCATGCCGCCCACCGTC
GCCAAACTGGAGAGGGAGCCGGTCCCGATGCACGCAGGTCGAGAATCGGCGGCGGGGACGGCTGTGCTCGACCGG
CATCCGGCATATCGCGCGCCAGACTACGGCTATTCGTACCACCACCACCCCAGTCGTTACCAGTCGCTCTCGACG
AGCTCGATCCGACCGCACGAGCGAGCGGCCTTCTCGGCCGGGGGCAACTACCACGCGCACTACCAGGACATGGGG
AGGCAGGGAGGCGATGTCGGGGGCGACGCCAAGCAACGGAAGCGGCGAGGAAACCTGCCCAAGGAGACGACGGAC
AAACTGCGGGCCTGGTTCGTGGCACATCTTCAACACCCGTACCCGACCGAGGACGAGAAGCAGGAATTGATGCGT
CAGACGGGCCTTCAGATGAACCAAATATCAAACTGGTTCATCAACGCGCGGCGGAGGCAGCTGCCGGCCATGATC
AACAACGCCAGGGCGGAGACAGAGGTGATGAACAGCCGGGTGGGCGGCGCCGGCGGGGACGGCGAGATCCTAGCA
TCGACGGAGCGAGCTGCCGACTTTTGCAAGCGTGGGGAAGGGTTGCCGGTCAGCGACGGCGAGGGGTGCGCCTAC
GACGAGGACATGAGCGGTCTACGGAAGCGTCGAATCGGCGATCTCAACCGGGAGAGCGTCTGA
Gene >Hirsu2|4383
ATGTCTATTCTTACCATGGCCACGCCACCACCGCACCCCCTGTTCAGGAACGACAGCCACTGGGATGCGGCCCAG
CCGTCTTCAGACTGCGCCCGACCGCGGACCGAGAATAGGTCGATCGTCGCCCTGCCGTCCATCCGCCAGGTATGA
GCCTACAGGATTCGGGGTCTCAAGGAGAGATTGATGGGGACTGCTCCGCTGACGACTCCCCTCGACAGACGTTTC
CCGAACTTCACCTCGAGGGGTCGCTAGCAGACGGGCCCGCAGCGAGGCCCTTCACCCACAGATCACCAAGTGTGG
CGGGTCCAGGGTCGCTCGCCTCACCAGAATACGTTCACTCGCCCAACACGAGCAAACGGAGGAGGATTTCGATGG
AGGACGAGCAGCTTCCGATGCGGTCTCAGTACGTGCCGAGGTTGTATCGGAGCCCCGAGCGGCCGCCTCCGCGAC
AGCTCTCGCCGCCCCATCGCGAACCGCCGACGGCCGAGAGCTGGGCGAGCCCGAGCCGGTTCGGATCCAGCAGCG
TGACCCCCGGTCCGATCGAAATGGACGGCAGAATCGAGCCACGGCCTGGGCTGCCGAGCATGCCGCCCACCGTCG
CCAAACTGGAGAGGGAGCCGGTCCCGATGCACGCAGGTCGAGAATCGGCGGCGGGGACGGCTGTGCTCGACCGGC
ATCCGGCATATCGCGCGCCAGACTACGGCTATTCGTACCACCACCACCCCAGTCGTTACCAGTCGCTCTCGACGA
GCTCGATCCGACCGCACGAGCGAGCGGCCTTCTCGGCCGGGGGCAACTACCACGCGCACTACCAGGACATGGGGA
GGCAGGGAGGCGATGTCGGGGGCGACGCCAAGCAACGGAAGCGGCGAGGAAACCTGCCCAAGGAGACGACGGACA
AACTGCGGGCCTGGTTCGTGGCACATCTTCAACACCCGTACCCGACCGAGGACGAGAAGCAGGAATTGATGCGTC
AGACGGGCCTTCAGATGAGTACGTCGAGAGCGTTGGCAAGCGGTGCGGCGAGTGGCGGGCTGGCTAACACGGGGC
AAACAGACCAAATATCAAACTGGTTCATCAACGCGCGGCGGAGGCAGCTGCCGGCCATGATCAACAACGCCAGGG
CGGAGACAGAGGTGATGAACAGCCGGGTGGGCGGCGCCGGCGGGGACGGCGAGATCCTAGCATCGACGGAGCGAG
CTGCCGACTTTTGCAAGCGTGGGGAAGGGTTGCCGGTCAGCGACGGCGAGGGGTGCGCCTACGACGAGGACATGA
GCGGTCTACGGAAGCGTCGAATCGGCGATCTCAACCGGGAGAGCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail