Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4378
Gene name
LocationContig_2231:925..3027
Strand+
Gene length (bp)2102
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain 5.8E-30 497 596
PF18151 DUF5601 Domain of unknown function (DUF5601) 8.6E-16 358 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74396|VPS91_SCHPO Vacuolar protein sorting-associated protein 9a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps901 PE=1 SV=3 339 606 9.0E-95
sp|P54787|VPS9_YEAST Vacuolar protein sorting-associated protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS9 PE=1 SV=2 339 606 4.0E-61
sp|Q9LT31|VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana GN=VPS9A PE=1 SV=1 341 606 3.0E-38
sp|O18973|RABX5_BOVIN Rab5 GDP/GTP exchange factor OS=Bos taurus GN=RABGEF1 PE=1 SV=1 340 606 5.0E-26
sp|Q9JM13|RABX5_MOUSE Rab5 GDP/GTP exchange factor OS=Mus musculus GN=Rabgef1 PE=1 SV=1 340 606 6.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74396|VPS91_SCHPO Vacuolar protein sorting-associated protein 9a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps901 PE=1 SV=3 339 606 9.0E-95
sp|P54787|VPS9_YEAST Vacuolar protein sorting-associated protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS9 PE=1 SV=2 339 606 4.0E-61
sp|Q9LT31|VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana GN=VPS9A PE=1 SV=1 341 606 3.0E-38
sp|O18973|RABX5_BOVIN Rab5 GDP/GTP exchange factor OS=Bos taurus GN=RABGEF1 PE=1 SV=1 340 606 5.0E-26
sp|Q9JM13|RABX5_MOUSE Rab5 GDP/GTP exchange factor OS=Mus musculus GN=Rabgef1 PE=1 SV=1 340 606 6.0E-26
sp|Q9UJ41|RABX5_HUMAN Rab5 GDP/GTP exchange factor OS=Homo sapiens GN=RABGEF1 PE=1 SV=2 413 606 1.0E-25
sp|A5D794|GAPD1_BOVIN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Bos taurus GN=GAPVD1 PE=2 SV=1 360 596 2.0E-22
sp|Q14C86|GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens GN=GAPVD1 PE=1 SV=2 360 596 4.0E-22
sp|Q6PAR5|GAPD1_MOUSE GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus GN=Gapvd1 PE=1 SV=2 360 596 4.0E-22
sp|A2RV61|GAPD1_XENLA GTPase-activating protein and VPS9 domain-containing protein 1 OS=Xenopus laevis GN=gapvd1 PE=2 SV=1 360 596 4.0E-20
sp|Q29HW3|RME6_DROPS Receptor-mediated endocytosis protein 6 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA14078 PE=3 SV=2 360 596 6.0E-20
sp|Q9VZ08|RME6_DROME Receptor-mediated endocytosis protein 6 homolog OS=Drosophila melanogaster GN=CG1657 PE=1 SV=2 360 596 3.0E-18
sp|Q9GYH7|RME6_CAEEL Receptor-mediated endocytosis protein 6 OS=Caenorhabditis elegans GN=rme-6 PE=1 SV=2 337 595 4.0E-12
sp|A8WVM4|RME6_CAEBR Receptor-mediated endocytosis protein 6 OS=Caenorhabditis briggsae GN=rme-6 PE=3 SV=1 363 595 2.0E-10
sp|Q9D684|RIN2_MOUSE Ras and Rab interactor 2 OS=Mus musculus GN=Rin2 PE=1 SV=3 496 595 5.0E-09
sp|Q8WYP3|RIN2_HUMAN Ras and Rab interactor 2 OS=Homo sapiens GN=RIN2 PE=1 SV=1 502 595 1.0E-08
sp|Q8TB24|RIN3_HUMAN Ras and Rab interactor 3 OS=Homo sapiens GN=RIN3 PE=1 SV=4 501 601 4.0E-08
sp|P59729|RIN3_MOUSE Ras and Rab interactor 3 OS=Mus musculus GN=Rin3 PE=1 SV=2 501 601 2.0E-07
sp|O94388|VPS92_SCHPO Vacuolar protein sorting-associated protein 9b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps902 PE=1 SV=1 461 605 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4378
MSSPELSTAIKTPAADDKTVSSDARLTAAADIGPERNHPDLPLPPHPHQSSHGRPSATTTTTITAPTTTDTAPGL
AIASKPAPAPAHSHGHVDAEPPQLPSAKGKHVFKPAAPAPEAKSAPSPTSAKAHAQPPPLAGTPAQYLAAEPSNY
VDPTPATPTTSQPPSRSPSNARSNRSDANSPARSDGGDKRHASDDEQDGGSRSEIQSIMEQFSEAGGGPGEDEVM
SPRLEIASPRLSSSMQLPPRRSSLEPLTPSIPAQLHEFNALRISTSSPSSVRSKDRSADDQGPPVPPKDGPFGGP
LARSNMDRLPSALASPSSPAMPVHRPPPPEPEPEPTLPFDFHRFLEQLRNKKADPVARYLKSFLSEFGKKQWMVH
EQVKIIGDFLAFIANKMAQCEVWRDVSDAEFDNAREGMEKLVMNRLYTQTFSPAIAPPKPVAGAKPKRRGADVPM
GPGRRGQHQEDVERDDVLTQKINIYGWIKEEHLDIPPFGESGRRFLKLAQQELLKIKSYRAPRDKIICVLNCSKV
IFGLLKHNKSDSSADSFMPLLIYVVLQSNPEHLVSNVQYILRFRNQEKLGGEAGYYLSSLMGAVQFIESMDRSSL
TISDDEGTI*
Coding >Hirsu2|4378
ATGTCTTCGCCGGAGCTGTCGACGGCCATCAAGACGCCTGCCGCCGACGACAAGACCGTCTCTTCTGATGCCCGC
CTGACGGCTGCTGCCGACATCGGCCCAGAGCGCAACCACCCCGATCTCCCTCTGCCTCCTCACCCTCATCAGTCG
TCCCACGGCCGGCCCTCTGCGACGACGACGACGACAATAACCGCGCCGACGACTACCGACACGGCCCCAGGCCTC
GCAATCGCCTCGAAGCCTGCCCCCGCGCCGGCGCATTCCCACGGCCATGTCGACGCCGAGCCACCCCAGTTGCCG
TCGGCCAAGGGCAAGCACGTCTTCAAGCCTGCAGCGCCTGCGCCCGAAGCCAAGTCGGCCCCTTCTCCGACCTCG
GCAAAGGCACATGCCCAGCCGCCTCCCCTAGCCGGAACCCCGGCCCAGTACCTCGCCGCCGAACCGTCCAACTAC
GTCGATCCCACGCCCGCCACCCCGACCACCTCGCAGCCGCCCTCCCGAAGCCCTTCCAACGCCCGGTCCAACCGC
TCCGATGCCAATTCTCCCGCGAGGTCGGATGGCGGCGACAAGAGGCATGCCAGCGACGACGAGCAGGACGGCGGC
TCCCGCTCCGAGATCCAGAGCATCATGGAGCAGTTCAGCGAGGCCGGCGGAGGCCCGGGCGAGGACGAGGTCATG
AGTCCCAGGTTGGAGATTGCCTCCCCCCGGCTGAGCAGCTCCATGCAGCTCCCGCCTCGAAGGTCCAGCCTGGAG
CCCCTGACCCCCTCCATCCCCGCGCAGCTGCACGAATTCAACGCCTTGCGCATCTCCACCTCCTCTCCTTCGAGC
GTCAGATCCAAGGACCGGTCGGCCGACGACCAGGGCCCCCCCGTGCCCCCGAAAGATGGTCCCTTCGGCGGGCCT
CTGGCACGCTCCAACATGGACCGTCTGCCCTCGGCCTTGGCCTCGCCCTCGTCGCCGGCCATGCCCGTCCATCGC
CCGCCTCCCCCGGAGCCGGAACCGGAGCCGACCCTGCCCTTTGATTTCCATCGATTCCTCGAGCAGCTGCGGAAC
AAGAAGGCCGATCCCGTCGCGAGGTATCTCAAGTCCTTTCTGTCCGAGTTCGGCAAGAAGCAGTGGATGGTGCAC
GAGCAGGTCAAGATCATTGGCGACTTCCTGGCCTTCATCGCCAACAAGATGGCCCAGTGCGAGGTGTGGAGGGAC
GTGTCCGATGCCGAGTTCGACAACGCCCGCGAGGGCATGGAGAAGCTCGTCATGAACAGACTCTACACCCAGACC
TTCTCGCCCGCCATTGCGCCCCCCAAGCCCGTCGCCGGGGCGAAGCCGAAGAGGCGCGGCGCCGACGTCCCCATG
GGGCCCGGCCGCCGCGGTCAGCACCAGGAAGATGTCGAGCGCGACGACGTCCTGACGCAGAAGATCAACATCTAC
GGTTGGATAAAAGAGGAGCACCTCGACATTCCCCCCTTCGGAGAGAGCGGACGCCGCTTTCTCAAGCTGGCGCAG
CAAGAACTGTTGAAGATCAAGTCGTATAGGGCACCGCGGGACAAGATCATTTGCGTCCTCAACTGCTCCAAGGTC
ATCTTCGGCCTCTTGAAGCACAACAAGTCGGATTCCTCGGCCGACTCCTTCATGCCCCTCCTCATCTACGTCGTC
CTCCAGTCGAATCCAGAACACCTAGTGTCTAATGTCCAGTACATCCTCCGATTCCGCAACCAGGAGAAGCTTGGC
GGCGAGGCGGGCTATTACCTGTCGTCACTGATGGGGGCCGTCCAGTTCATCGAGAGCATGGACCGCTCGTCGCTC
ACCATTTCCGACGACGAAGGCACTATCTGA
Transcript >Hirsu2|4378
ATGTCTTCGCCGGAGCTGTCGACGGCCATCAAGACGCCTGCCGCCGACGACAAGACCGTCTCTTCTGATGCCCGC
CTGACGGCTGCTGCCGACATCGGCCCAGAGCGCAACCACCCCGATCTCCCTCTGCCTCCTCACCCTCATCAGTCG
TCCCACGGCCGGCCCTCTGCGACGACGACGACGACAATAACCGCGCCGACGACTACCGACACGGCCCCAGGCCTC
GCAATCGCCTCGAAGCCTGCCCCCGCGCCGGCGCATTCCCACGGCCATGTCGACGCCGAGCCACCCCAGTTGCCG
TCGGCCAAGGGCAAGCACGTCTTCAAGCCTGCAGCGCCTGCGCCCGAAGCCAAGTCGGCCCCTTCTCCGACCTCG
GCAAAGGCACATGCCCAGCCGCCTCCCCTAGCCGGAACCCCGGCCCAGTACCTCGCCGCCGAACCGTCCAACTAC
GTCGATCCCACGCCCGCCACCCCGACCACCTCGCAGCCGCCCTCCCGAAGCCCTTCCAACGCCCGGTCCAACCGC
TCCGATGCCAATTCTCCCGCGAGGTCGGATGGCGGCGACAAGAGGCATGCCAGCGACGACGAGCAGGACGGCGGC
TCCCGCTCCGAGATCCAGAGCATCATGGAGCAGTTCAGCGAGGCCGGCGGAGGCCCGGGCGAGGACGAGGTCATG
AGTCCCAGGTTGGAGATTGCCTCCCCCCGGCTGAGCAGCTCCATGCAGCTCCCGCCTCGAAGGTCCAGCCTGGAG
CCCCTGACCCCCTCCATCCCCGCGCAGCTGCACGAATTCAACGCCTTGCGCATCTCCACCTCCTCTCCTTCGAGC
GTCAGATCCAAGGACCGGTCGGCCGACGACCAGGGCCCCCCCGTGCCCCCGAAAGATGGTCCCTTCGGCGGGCCT
CTGGCACGCTCCAACATGGACCGTCTGCCCTCGGCCTTGGCCTCGCCCTCGTCGCCGGCCATGCCCGTCCATCGC
CCGCCTCCCCCGGAGCCGGAACCGGAGCCGACCCTGCCCTTTGATTTCCATCGATTCCTCGAGCAGCTGCGGAAC
AAGAAGGCCGATCCCGTCGCGAGGTATCTCAAGTCCTTTCTGTCCGAGTTCGGCAAGAAGCAGTGGATGGTGCAC
GAGCAGGTCAAGATCATTGGCGACTTCCTGGCCTTCATCGCCAACAAGATGGCCCAGTGCGAGGTGTGGAGGGAC
GTGTCCGATGCCGAGTTCGACAACGCCCGCGAGGGCATGGAGAAGCTCGTCATGAACAGACTCTACACCCAGACC
TTCTCGCCCGCCATTGCGCCCCCCAAGCCCGTCGCCGGGGCGAAGCCGAAGAGGCGCGGCGCCGACGTCCCCATG
GGGCCCGGCCGCCGCGGTCAGCACCAGGAAGATGTCGAGCGCGACGACGTCCTGACGCAGAAGATCAACATCTAC
GGTTGGATAAAAGAGGAGCACCTCGACATTCCCCCCTTCGGAGAGAGCGGACGCCGCTTTCTCAAGCTGGCGCAG
CAAGAACTGTTGAAGATCAAGTCGTATAGGGCACCGCGGGACAAGATCATTTGCGTCCTCAACTGCTCCAAGGTC
ATCTTCGGCCTCTTGAAGCACAACAAGTCGGATTCCTCGGCCGACTCCTTCATGCCCCTCCTCATCTACGTCGTC
CTCCAGTCGAATCCAGAACACCTAGTGTCTAATGTCCAGTACATCCTCCGATTCCGCAACCAGGAGAAGCTTGGC
GGCGAGGCGGGCTATTACCTGTCGTCACTGATGGGGGCCGTCCAGTTCATCGAGAGCATGGACCGCTCGTCGCTC
ACCATTTCCGACGACGAAGGCACTATCTGA
Gene >Hirsu2|4378
ATGTCTTCGCCGGAGCTGTCGACGGCCATCAAGACGCCTGCCGCCGACGACAAGACCGTCTCTTCTGATGCCCGC
CTGACGGCTGCTGCCGACATCGGCCCAGAGCGCAACCACCCCGATCTCCCTCTGCCTCCTCACCCTCATCAGTCG
TCCCACGGCCGGCCCTCTGCGACGACGACGACGACAATAACCGCGCCGACGACTACCGACACGGCCCCAGGCCTC
GCAATCGCCTCGAAGCCTGCCCCCGCGCCGGCGCATTCCCACGGCCATGTCGACGCCGAGCCACCCCAGTTGCCG
TCGGCCAAGGGCAAGCACGTCTTCAAGCCTGCAGCGCCTGCGCCCGAAGCCAAGTCGGCCCCTTCTCCGACCTCG
GCAAAGGCACATGCCCAGCCGCCTCCCCTAGCCGGAACCCCGGCCCAGTACCTCGCCGCCGAACCGTCCAACTAC
GTCGATCCCACGCCCGCCACCCCGACCACCTCGCAGCCGCCCTCCCGAAGCCCTTCCAACGCCCGGTCCAACCGC
TCCGATGCCAATTCTCCCGCGAGGTCGGATGGCGGCGACAAGAGGCATGCCAGCGACGACGAGCAGGACGGCGGC
TCCCGCTCCGAGATCCAGAGCATCATGGAGCAGTTCAGCGAGGCCGGCGGAGGCCCGGGCGAGGACGAGGTCATG
AGTCCCAGGTTGGAGATTGCCTCCCCCCGGCTGAGCAGCTCCATGCAGCTCCCGCCTCGAAGGTCCAGCCTGGAG
CCCCTGACCCCCTCCATCCCCGCGCAGCTGCACGAATTCAACGCCTTGCGCATCTCCACCTCCTCTCCTTCGAGC
GTCAGATCCAAGGACCGGTCGGCCGACGACCAGGGCCCCCCCGTGCCCCCGAAAGATGGTCCCTTCGGCGGGCCT
CTGGCACGCTCCAACATGGACCGTCTGCCCTCGGCCTTGGCCTCGCCCTCGTCGCCGGCCATGCCCGTCCATCGC
CCGCCTCCCCCGGAGCCGGAACCGGAGCCGACCCTGCCCTTTGATTTCCATCGATTCCTCGAGCAGCTGCGGAAC
AAGAAGGCCGATCCCGTCGCGAGGTATCTCAAGTCCTTTCTGTCCGAGTTCGGCAAGAAGCAGTGGATGGTGCAC
GAGCAGGTCAAGATCATTGGCGACTTCCTGGCCTTCATCGCCAACAAGATGGCCCAGTGCGAGGTGTGGAGGGAC
GTGTCCGATGCCGAGTTCGACAACGCCCGCGAGGGCATGGAGAAGCTCGTCATGAACAGACTCTACACCCAGACC
TTCTCGCCCGCCATTGCGCCCCCCAAGCCCGTCGCCGGGGCGAAGCCGAAGAGGCGCGGCGCCGACGTCCCCATG
GGGCCCGGCCGCCGCGGTCAGCACCAGGAAGATGTCGAGCGCGACGACGTCCTGACGCAGAAGATCAACATCTAC
GGTTGGATAAAAGAGGAGCACCTCGACATTCCCCCCTTCGGAGAGAGCGGACGCCGCTTTCTCAAGCTGGCGCAG
CAAGGTTAGTCTCGCCCCGGTCCCCGGCTCTCGGAGGAGCGGCCCACAGGACGGGCAGACAGACGAGGAGGAAGG
ACAGAGAAGAGCGGAACTTGCCTAACCCTTATTAACAGAACTGTTGAAGATCAAGTCGTATAGGGCACCGCGGGA
CAAGATCATTTGCGTCCTCAACTGCTCCAAGGTCATCTTCGGTAAGCTACCACCCCCCCCACTCCCTTCTTCTGC
CGCCTCCTCCACTCACAGTCGCAGGCCTCTTGAAGCACAACAAGTCGGATTCCTCGGCCGACTCCTTCATGCCCC
TCCTCATCTACGTCGTCCTCCAGTCGAATCCAGAACACCTAGTGTCTAATGTCCAGTACATCCTCCGATTCCGCA
ACCAGGAGAAGCTTGGCGGCGAGGCGGGCTATTACCTGTCGTCACTGGTAGGTCGAGGCACCCAAACACGTCGCG
CAGGATCCGACGCTGACAGAAGACCTAAAAAAAGATGGGGGCCGTCCAGTTCATCGAGAGCATGGACCGCTCGTC
GCTCACCATTTCCGACGACGAGTTCGAGAGGAACGTCGAAGCCGCCGTGTCAGCCATCGCCGAGAGGCACTATCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail