Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4375
Gene name
LocationContig_223:21279..22546
Strand-
Gene length (bp)1267
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12326 EOS1 N-glycosylation protein 3.0E-17 166 248

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8TFH6|EOS1_SCHPO N-glycosylation protein eos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eos1 PE=3 SV=3 171 246 4.0E-07

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0034599 cellular response to oxidative stress Yes
GO:0033554 cellular response to stress No
GO:0044446 intracellular organelle part No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0070887 cellular response to chemical stimulus No
GO:0044432 endoplasmic reticulum part No
GO:0008150 biological_process No
GO:0006979 response to oxidative stress No
GO:0044422 organelle part No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0006950 response to stress No
GO:0044424 intracellular part No
GO:0016020 membrane No
GO:0042221 response to chemical No
GO:0044425 membrane part No
GO:0051716 cellular response to stimulus No
GO:0050896 response to stimulus No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 161 183 22
3 204 226 22
4 231 250 19
5 263 285 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4375
MATTVRPHHRASSTASSLSDKIASSPPPPLYSEAGLGRSRAAAASAAAASQLRPPALSSPHSSRSSSTSTPNPGA
SPPSVYPSVLQPRVAVVLNVPQPWHPWLFALRLASILPAVWWGLPSALQLLLGLLPGPDRVLVVRQGRSPPAALC
DSASPDDAVPYALVEAALATIWCFACGYLSFFFTDCLMSRWLINYTPQATIVRLLSINAVNAYVTLTVLSVTGGF
DDPRLLLPGWIGIATTLTVCYHITHQKINIRKETSTSINVFSIASYITMVTLLALMHSRLADYPTMPFVARARHM
WDEAVGLLTHIKGAVERGEL*
Coding >Hirsu2|4375
ATGGCGACGACGGTCCGCCCTCATCATCGGGCTTCGTCTACCGCCTCGTCCCTCTCCGACAAGATCGCCTCCTCG
CCGCCGCCGCCCCTGTATTCCGAGGCCGGCCTCGGCCGATCCCGCGCCGCCGCCGCCTCGGCCGCCGCCGCCTCC
CAGCTCCGCCCCCCGGCATTGTCGTCGCCGCATTCGAGCCGCTCGTCGTCGACGTCGACGCCAAACCCCGGCGCC
TCGCCTCCATCCGTCTACCCTTCGGTCCTTCAGCCTCGCGTCGCCGTCGTCCTCAACGTGCCCCAGCCATGGCAC
CCCTGGCTCTTCGCCCTCCGCCTCGCCTCCATCCTCCCGGCCGTCTGGTGGGGGCTGCCCTCGGCCCTCCAGCTC
CTCCTGGGCCTGCTGCCCGGCCCGGACCGTGTCCTCGTCGTCCGCCAGGGCCGCTCCCCCCCCGCCGCCCTTTGT
GACTCCGCATCCCCCGATGACGCCGTTCCCTACGCTCTGGTCGAGGCCGCCCTCGCCACAATATGGTGTTTCGCC
TGCGGCTACCTTTCCTTCTTCTTCACCGACTGCTTGATGTCCCGGTGGCTCATCAACTACACCCCTCAAGCAACC
ATCGTTCGACTCCTCAGCATCAATGCCGTCAACGCTTACGTGACCCTCACCGTCCTCTCCGTCACCGGCGGCTTC
GACGATCCTCGCCTTCTGCTGCCGGGCTGGATCGGAATCGCAACAACTCTGACCGTCTGCTACCACATCACGCAC
CAAAAGATCAATATCCGCAAGGAGACCTCCACCTCTATCAACGTCTTCTCCATCGCCAGCTACATCACCATGGTC
ACCCTGCTCGCCCTCATGCATTCGCGGCTGGCCGATTATCCCACCATGCCCTTCGTCGCTCGCGCTCGCCATATG
TGGGACGAGGCTGTTGGCTTGCTGACACACATCAAAGGCGCCGTCGAGCGGGGTGAATTGTGA
Transcript >Hirsu2|4375
ATGGCGACGACGGTCCGCCCTCATCATCGGGCTTCGTCTACCGCCTCGTCCCTCTCCGACAAGATCGCCTCCTCG
CCGCCGCCGCCCCTGTATTCCGAGGCCGGCCTCGGCCGATCCCGCGCCGCCGCCGCCTCGGCCGCCGCCGCCTCC
CAGCTCCGCCCCCCGGCATTGTCGTCGCCGCATTCGAGCCGCTCGTCGTCGACGTCGACGCCAAACCCCGGCGCC
TCGCCTCCATCCGTCTACCCTTCGGTCCTTCAGCCTCGCGTCGCCGTCGTCCTCAACGTGCCCCAGCCATGGCAC
CCCTGGCTCTTCGCCCTCCGCCTCGCCTCCATCCTCCCGGCCGTCTGGTGGGGGCTGCCCTCGGCCCTCCAGCTC
CTCCTGGGCCTGCTGCCCGGCCCGGACCGTGTCCTCGTCGTCCGCCAGGGCCGCTCCCCCCCCGCCGCCCTTTGT
GACTCCGCATCCCCCGATGACGCCGTTCCCTACGCTCTGGTCGAGGCCGCCCTCGCCACAATATGGTGTTTCGCC
TGCGGCTACCTTTCCTTCTTCTTCACCGACTGCTTGATGTCCCGGTGGCTCATCAACTACACCCCTCAAGCAACC
ATCGTTCGACTCCTCAGCATCAATGCCGTCAACGCTTACGTGACCCTCACCGTCCTCTCCGTCACCGGCGGCTTC
GACGATCCTCGCCTTCTGCTGCCGGGCTGGATCGGAATCGCAACAACTCTGACCGTCTGCTACCACATCACGCAC
CAAAAGATCAATATCCGCAAGGAGACCTCCACCTCTATCAACGTCTTCTCCATCGCCAGCTACATCACCATGGTC
ACCCTGCTCGCCCTCATGCATTCGCGGCTGGCCGATTATCCCACCATGCCCTTCGTCGCTCGCGCTCGCCATATG
TGGGACGAGGCTGTTGGCTTGCTGACACACATCAAAGGCGCCGTCGAGCGGGGTGAATTGTGA
Gene >Hirsu2|4375
ATGGCGACGACGGTCCGCCCTCATCATCGGGCTTCGTCTACCGCCTCGTCCCTCTCCGACAAGATCGCCTCCTCG
CCGCCGCCGCCCCTGTATTCCGAGGCCGGCCTCGGCCGATCCCGCGCCGCCGCCGCCTCGGCCGCCGCCGCCTCC
CAGCTCCGCCCCCCGGCATTGTCGTCGCCGCATTCGAGCCGCTCGTCGTCGACGTCGACGCCAAACCCCGGCGCC
TCGCCTCCATCCGTCTACCCTTCGGTCCTTCAGCCTCGCGTCGCCGTCGTCCTCAACGTGCCCCAGCCATGGCAC
CCCTGGCTCTTCGCCCTCCGCCTCGCCTCCATCCTCCCGGCCGTCTGGTGGGGGCTGCCCTCGGCCCTCCAGCTC
CTCCTGGGCCTGCTGCCCGGCCCGGACCGTGTCCTCGTCGTCCGCCAGGGCCGCTCCCCCCCCGCCGCCCTTTGT
GACTCCGCATCCCCCGATGACGCCGTTCCCTACGCTCTGGTCGAGGCCGCCCTCGCCACAATATGGGTGCGTCGT
GGCACCGTCTCCCCCGACACCATCTCCTCCGGCGCCGCTCGTCGGCTAACCCTTGCCTCGCAGTGTTTCGCCTGC
GGCTACCTTTCCTTCTTCTTCACCGACTGCTTGATGTCCCGGTGGTACGTTCGCCTCGCTGCCCTGCCCGGGCTG
GCAAAACCTCCTTGGAACACGAGGCACTGCTGACCTCGTCTCTTCTCGCATTTGCCCAGGCTCATCAACTACACC
CCTCAAGCAACCATCGTTCGACTCCTCAGCATCAATGCCGTCAACGCTTACGTGACCCTCACCGTCCTCTCCGTC
ACCGGCGGCTTCGACGATCCTCGCCTTCTGCTGCCGGGCTGGATCGGAATCGCAACAGTTCGTCTCCCCCCCTTT
CCCTCGGGGCCTTGTCCACAGCCGACCCAAATACCCCCCCGACATCTAGTCTGTCATGTGGCACGGCTGTCTGCT
CGTAGGCAAGCGAGGCTCAAGAACAGCCATCTAACTTGTCCTTTCCCAGACTCTGACCGTCTGCTACCACATCAC
GCACCAAAAGATCAATATCCGCAAGGAGACCTCCACCTCTATCAACGTCTTCTCCATCGCCAGCTACATCACCAT
GGTCACCCTGCTCGCCCTCATGCATTCGCGGCTGGCCGATTATCCCACCATGCCCTTCGTCGCTCGCGCTCGCCA
TATGTGGGACGAGGCTGTTGGCTTGCTGACACACATCAAAGGCGCCGTCGAGCGGGGTGAATTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail