Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4371
Gene name
LocationContig_223:11122..12537
Strand-
Gene length (bp)1415
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4938 0.2988 0.2581 0.1943 0.3487 0.3285 0.4023 0.4953 0.5468 0.1428

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4750
Ophiocordyceps australis map64 (Brazil) OphauB2|6834
Ophiocordyceps camponoti-floridani Ophcf2|01619
Ophiocordyceps camponoti-rufipedis Ophun1|7407
Ophiocordyceps kimflemingae Ophio5|7578
Ophiocordyceps subramaniannii Hirsu2|4371 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4371
MASWIERGFVVDMGFLPQQHARMADVLPSLDSASCVSALSLARLPRASLPGSGSGSGSGSGSGSGSGVFLPPPPL
LLFHGSVSLSTVVSPLFRPISLSLSSLLLSRALCVCPVSLLLHLLGQTSLLSASFPSRPPLAFSPSPYYHPDAHS
PRAEVLCLAVPASAALVSLQDLNLGSPWLLEAGSVRPSMARKVHLHWTHDPRFNHLRTPPSWYHRNPGLFFTPAP
SARMEKQAAVERKRQWLSQAGEDVGGSTGGSWLEAVCWPCGLYARADSRLRLALSGRNVERTPEPGFCNPDCVQY
AVCLPFYGCLIARVQTVVRSFYGIDGRDVSDWYDGCCCPCATLIRNEREILVREKQHAQLRDLHQPDAFVKSQYH
AQPPMSYDVPPCGLDREAKGPGKAAATPTSTRSHEEIAVPLVRCLDQH*
Coding >Hirsu2|4371
ATGGCTTCCTGGATCGAAAGGGGCTTCGTGGTCGATATGGGCTTCCTTCCGCAGCAGCACGCGCGGATGGCCGAC
GTCCTCCCCTCTCTCGATTCTGCCTCGTGTGTTTCCGCCTTGTCTCTTGCTCGCCTTCCTCGCGCCTCTCTCCCT
GGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCAGGCGTCTTCTTGCCCCCCCCCCCTCTC
CTTCTCTTCCACGGCTCTGTCTCTCTTTCTACCGTCGTCTCTCCCCTCTTCCGCCCAATCTCTCTCTCTCTCTCG
TCTCTTCTTCTCTCCCGCGCTCTCTGCGTCTGTCCCGTCTCTCTCTTGTTGCATCTTCTAGGCCAAACATCTCTG
CTTTCTGCATCATTTCCCTCTCGCCCGCCGCTGGCCTTCTCACCCTCTCCTTATTACCACCCCGACGCTCACTCA
CCGAGGGCCGAGGTGCTGTGTCTCGCCGTCCCGGCTTCGGCTGCTCTTGTCTCTCTCCAGGACCTGAATCTCGGG
TCACCTTGGCTGCTTGAGGCTGGGTCCGTCCGGCCGAGTATGGCTCGCAAGGTTCACCTTCACTGGACACACGAC
CCTCGCTTCAACCACCTGCGAACACCCCCTTCCTGGTACCACCGCAACCCCGGCCTCTTCTTCACGCCCGCCCCG
AGCGCGAGGATGGAGAAGCAGGCGGCCGTCGAGCGCAAGAGGCAGTGGCTGTCGCAAGCTGGCGAGGACGTCGGC
GGCTCGACCGGCGGCTCGTGGCTCGAGGCGGTCTGTTGGCCGTGCGGCTTGTACGCCCGTGCCGATTCTCGCCTG
CGACTTGCCCTCTCGGGCCGCAACGTCGAGAGGACGCCGGAGCCGGGCTTCTGCAACCCGGACTGCGTCCAGTAC
GCCGTCTGCCTGCCCTTCTATGGCTGCCTCATCGCCCGCGTCCAGACGGTGGTGCGGTCCTTCTACGGCATCGAC
GGCCGCGATGTGTCCGACTGGTATGATGGTTGCTGCTGCCCGTGCGCGACACTGATCCGCAACGAGCGCGAGATC
CTGGTGCGCGAGAAGCAGCACGCCCAACTCAGGGACCTGCATCAGCCGGACGCCTTTGTCAAATCGCAGTACCAC
GCGCAGCCGCCCATGAGCTACGATGTTCCCCCGTGCGGGCTGGACAGGGAGGCGAAGGGCCCGGGCAAGGCGGCG
GCGACGCCGACATCGACAAGGTCGCACGAGGAGATTGCCGTCCCTCTCGTCCGCTGCCTCGACCAGCACTAG
Transcript >Hirsu2|4371
ATGGCTTCCTGGATCGAAAGGGGCTTCGTGGTCGATATGGGCTTCCTTCCGCAGCAGCACGCGCGGATGGCCGAC
GTCCTCCCCTCTCTCGATTCTGCCTCGTGTGTTTCCGCCTTGTCTCTTGCTCGCCTTCCTCGCGCCTCTCTCCCT
GGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCAGGCGTCTTCTTGCCCCCCCCCCCTCTC
CTTCTCTTCCACGGCTCTGTCTCTCTTTCTACCGTCGTCTCTCCCCTCTTCCGCCCAATCTCTCTCTCTCTCTCG
TCTCTTCTTCTCTCCCGCGCTCTCTGCGTCTGTCCCGTCTCTCTCTTGTTGCATCTTCTAGGCCAAACATCTCTG
CTTTCTGCATCATTTCCCTCTCGCCCGCCGCTGGCCTTCTCACCCTCTCCTTATTACCACCCCGACGCTCACTCA
CCGAGGGCCGAGGTGCTGTGTCTCGCCGTCCCGGCTTCGGCTGCTCTTGTCTCTCTCCAGGACCTGAATCTCGGG
TCACCTTGGCTGCTTGAGGCTGGGTCCGTCCGGCCGAGTATGGCTCGCAAGGTTCACCTTCACTGGACACACGAC
CCTCGCTTCAACCACCTGCGAACACCCCCTTCCTGGTACCACCGCAACCCCGGCCTCTTCTTCACGCCCGCCCCG
AGCGCGAGGATGGAGAAGCAGGCGGCCGTCGAGCGCAAGAGGCAGTGGCTGTCGCAAGCTGGCGAGGACGTCGGC
GGCTCGACCGGCGGCTCGTGGCTCGAGGCGGTCTGTTGGCCGTGCGGCTTGTACGCCCGTGCCGATTCTCGCCTG
CGACTTGCCCTCTCGGGCCGCAACGTCGAGAGGACGCCGGAGCCGGGCTTCTGCAACCCGGACTGCGTCCAGTAC
GCCGTCTGCCTGCCCTTCTATGGCTGCCTCATCGCCCGCGTCCAGACGGTGGTGCGGTCCTTCTACGGCATCGAC
GGCCGCGATGTGTCCGACTGGTATGATGGTTGCTGCTGCCCGTGCGCGACACTGATCCGCAACGAGCGCGAGATC
CTGGTGCGCGAGAAGCAGCACGCCCAACTCAGGGACCTGCATCAGCCGGACGCCTTTGTCAAATCGCAGTACCAC
GCGCAGCCGCCCATGAGCTACGATGTTCCCCCGTGCGGGCTGGACAGGGAGGCGAAGGGCCCGGGCAAGGCGGCG
GCGACGCCGACATCGACAAGGTCGCACGAGGAGATTGCCGTCCCTCTCGTCCGCTGCCTCGACCAGCACTAG
Gene >Hirsu2|4371
ATGGCTTCCTGGATCGAAAGGGGCTTCGTGGTCGATATGGGCTTCCTTCCGCAGCAGCACGCGCGGATGGCCGAC
GTCCTCCCCTCTCTCGATTCTGCCTCGTGTGTTTCCGCCTTGTCTCTTGCTCGCCTTCCTCGCGCCTCTCTCCCT
GGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTCAGGCGTCTTCTTGCCCCCCCCCCCTCTC
CTTCTCTTCCACGGCTCTGTCTCTCTTTCTACCGTCGTCTCTCCCCTCTTCCGCCCAATCTCTCTCTCTCTCTCG
TCTCTTCTTCTCTCCCGCGCTCTCTGCGTCTGTCCCGTCTCTCTCTTGTTGCATCTTCTAGGCCAAACATCTCTG
CTTTCTGCATCATTTCCCTCTCGCCCGCCGCTGGCCTTCTCACCCTCTCCTTATTACCACCCCGACGCTCACTCA
CCGAGGGCCGAGGTGCTGTGTCTCGCCGTCCCGGCTTCGGCTGCTCTTGTCTCTCTCCAGGACCTGAATCTCGGG
TCACCTTGGTTGGAACAAGACGCGTGCCCCCACTCGCCATCTCGCTAGCCATCACGACGACAACGGTGGGAGAGG
CTGCTTGAGGCTGGGTCCGTCCGGCCGAGTATGGCTCGCAAGGTTCACCTTCACTGGACACACGACCCTCGCTTC
AACCACCTGCGAACACCCCCTTCCTGGTACCACCGCAACCCCGGCCTCTTCTTCACGCCCGCCCCGAGCGCGAGG
ATGGAGAAGCAGGCGGCCGTCGAGCGCAAGAGGCAGTGGCTGTCGCAAGCTGGCGAGGACGTCGGCGGCTCGACC
GGCGGCTCGTGGCTCGAGGCGGTCTGTTGGCCGTGCGGCTTGTACGCCCGTGCCGATTCTCGCCTGCGACTTGCC
CTCTCGGGCCGCAACGTCGAGAGGACGCCGGAGCCGGGCTTCTGCAACCCGGACTGCGTCCAGTACGCCGTCTGC
CTGCCCTGTGCGCATCTCTTTCTCCCTCTCTCTCTCCCCGACGACGCGCGGACGTGCTGACTGACTGACTGGTGC
CGGCGACAGTCTATGGCTGCCTCATCGCCCGCGTCCAGACGGTGGTGCGGTCCTTCTACGGCATCGACGGCCGCG
ATGTGTCCGACTGGTATGATGGTTGCTGCTGCCCGTGCGCGACACTGATCCGCAACGAGCGCGAGATCCTGGTGC
GCGAGAAGCAGCACGCCCAACTCAGGGACCTGCATCAGCCGGACGCCTTTGTCAAATCGCAGTACCACGCGCAGC
CGCCCATGAGCTACGATGTTCCCCCGTGCGGGCTGGACAGGGAGGCGAAGGGCCCGGGCAAGGCGGCGGCGACGC
CGACATCGACAAGGTCGCACGAGGAGATTGCCGTCCCTCTCGTCCGCTGCCTCGACCAGCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail