Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4364
Gene name
LocationContig_2229:92..1072
Strand-
Gene length (bp)980
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 2.2E-64 70 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8ZI10|RSB1_YEAS8 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RSB1 PE=3 SV=1 32 281 3.0E-28
sp|B3LJA1|RSB1_YEAS1 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSB1 PE=3 SV=2 32 281 9.0E-28
sp|Q08417|RSB1_YEAST Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSB1 PE=1 SV=3 32 281 1.0E-27
sp|A6ZNQ4|RSB1_YEAS7 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RSB1 PE=3 SV=2 32 281 1.0E-27
sp|B5VRU8|RSB1_YEAS6 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSB1 PE=3 SV=1 32 281 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8ZI10|RSB1_YEAS8 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RSB1 PE=3 SV=1 32 281 3.0E-28
sp|B3LJA1|RSB1_YEAS1 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSB1 PE=3 SV=2 32 281 9.0E-28
sp|Q08417|RSB1_YEAST Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSB1 PE=1 SV=3 32 281 1.0E-27
sp|A6ZNQ4|RSB1_YEAS7 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RSB1 PE=3 SV=2 32 281 1.0E-27
sp|B5VRU8|RSB1_YEAS6 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSB1 PE=3 SV=1 32 281 1.0E-27
sp|C7GLH7|RSB1_YEAS2 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RSB1 PE=3 SV=2 32 276 2.0E-27
sp|O13780|YEO2_SCHPO Uncharacterized protein C17G6.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.02c PE=4 SV=1 31 302 2.0E-19
sp|P40113|RTM1_YEASX Protein RTM1 OS=Saccharomyces cerevisiae GN=RTM1 PE=3 SV=1 70 270 3.0E-13
sp|P53047|RTA1_YEAST Protein RTA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTA1 PE=1 SV=1 28 261 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22
2 64 86 22
3 96 118 22
4 138 160 22
5 175 197 22
6 210 232 22
7 252 274 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4364
MSARQLPPGVKTFGPNANCTLDTCPAEWSIYGLRPSLAANTTFLVLFALIGIVHTYLGFRWRSWGFMGGMMLGCL
NEIIGYAGRIMLWYNPFSFVGFMVQIICLTIAPVFYTASIYVTLSKAIVHFAPDLSRFRPQLFYWIFIPFDVVCL
ILQAVGGALSTRSGGRNQAGVNVSMAGLALQVIILTAFIAVFADYMVRYLRSGRLSGFGWRLNGFFLGLTAAILL
ILARCAYRVAELRDGYHGALIREEVPFIVLEGVFIVLAGFALCLGHPGLVFGRGVARKGSGAEWEGSESGTGTGT
PERK*
Coding >Hirsu2|4364
ATGTCGGCGAGGCAGCTCCCGCCCGGCGTCAAGACGTTCGGCCCCAACGCCAACTGCACGCTCGACACGTGTCCC
GCCGAATGGAGCATCTACGGGCTGCGGCCGTCGCTGGCGGCCAACACGACCTTCCTCGTGCTCTTCGCCCTCATC
GGCATCGTCCACACCTACCTCGGCTTCCGGTGGAGGAGCTGGGGCTTCATGGGCGGCATGATGCTCGGCTGCCTC
AACGAGATCATCGGCTACGCCGGCCGCATCATGCTGTGGTATAACCCGTTTTCCTTTGTCGGGTTCATGGTCCAG
ATCATCTGCCTGACGATCGCGCCCGTCTTCTACACGGCCTCGATCTACGTGACGCTGTCCAAGGCCATCGTGCAC
TTCGCGCCGGACCTGTCGCGCTTCCGGCCGCAGCTCTTCTACTGGATCTTCATCCCCTTCGACGTCGTCTGCCTC
ATCCTGCAGGCCGTGGGCGGCGCGCTGTCGACGCGGTCGGGCGGGCGCAACCAGGCGGGCGTCAACGTGTCCATG
GCCGGGCTGGCGCTGCAGGTCATCATCCTGACGGCCTTCATCGCCGTCTTCGCCGACTACATGGTGCGCTACCTG
CGCTCGGGCCGGCTGTCGGGCTTCGGCTGGCGCCTCAACGGCTTCTTCCTCGGCCTGACGGCCGCCATCCTGCTG
ATCCTGGCCCGCTGCGCCTACCGCGTGGCCGAGCTGCGCGACGGCTACCACGGCGCCCTGATCCGCGAGGAGGTG
CCGTTCATCGTGCTCGAGGGCGTCTTCATCGTCCTGGCCGGCTTCGCCCTGTGCCTCGGCCACCCGGGCCTGGTC
TTTGGCCGCGGCGTCGCCCGCAAGGGCTCCGGCGCCGAGTGGGAGGGGAGCGAGAGCGGCACGGGCACGGGCACG
CCGGAGCGCAAGTAG
Transcript >Hirsu2|4364
ATGTCGGCGAGGCAGCTCCCGCCCGGCGTCAAGACGTTCGGCCCCAACGCCAACTGCACGCTCGACACGTGTCCC
GCCGAATGGAGCATCTACGGGCTGCGGCCGTCGCTGGCGGCCAACACGACCTTCCTCGTGCTCTTCGCCCTCATC
GGCATCGTCCACACCTACCTCGGCTTCCGGTGGAGGAGCTGGGGCTTCATGGGCGGCATGATGCTCGGCTGCCTC
AACGAGATCATCGGCTACGCCGGCCGCATCATGCTGTGGTATAACCCGTTTTCCTTTGTCGGGTTCATGGTCCAG
ATCATCTGCCTGACGATCGCGCCCGTCTTCTACACGGCCTCGATCTACGTGACGCTGTCCAAGGCCATCGTGCAC
TTCGCGCCGGACCTGTCGCGCTTCCGGCCGCAGCTCTTCTACTGGATCTTCATCCCCTTCGACGTCGTCTGCCTC
ATCCTGCAGGCCGTGGGCGGCGCGCTGTCGACGCGGTCGGGCGGGCGCAACCAGGCGGGCGTCAACGTGTCCATG
GCCGGGCTGGCGCTGCAGGTCATCATCCTGACGGCCTTCATCGCCGTCTTCGCCGACTACATGGTGCGCTACCTG
CGCTCGGGCCGGCTGTCGGGCTTCGGCTGGCGCCTCAACGGCTTCTTCCTCGGCCTGACGGCCGCCATCCTGCTG
ATCCTGGCCCGCTGCGCCTACCGCGTGGCCGAGCTGCGCGACGGCTACCACGGCGCCCTGATCCGCGAGGAGGTG
CCGTTCATCGTGCTCGAGGGCGTCTTCATCGTCCTGGCCGGCTTCGCCCTGTGCCTCGGCCACCCGGGCCTGGTC
TTTGGCCGCGGCGTCGCCCGCAAGGGCTCCGGCGCCGAGTGGGAGGGGAGCGAGAGCGGCACGGGCACGGGCACG
CCGGAGCGCAAGTAG
Gene >Hirsu2|4364
ATGTCGGCGAGGCAGCTCCCGCCCGGCGTCAAGACGTTCGGCCCCAACGCCAACTGCACGCTCGACACGTGTCCC
GCCGAATGGAGCATCTACGGGCTGCGGCCGTCGCTGGCGGCCAACACGACCTTCCTCGTGCTCTTCGCCCTCATC
GGCATCGTCCACACCTACCTCGGCTTCCGGTGGAGGAGCTGGGGCTTCATGGGCGGCATGATGCTCGGCTGCCTC
AACGAGATCATCGGCTACGCCGGCCGCATCATGCTGTGGTATAACCCGTTTTCCTTTGTCGGGTTCATGGTCCAG
ATCAGTGAGTCCCCCCCCCCTCTTTCCCTCCTCCCCGCGCCGTGCCGCGACTAACGAACCGGCCGGCAGTCTGCC
TGACGATCGCGCCCGTCTTCTACACGGCCTCGATCTACGTGACGCTGTCCAAGGCCATCGTGCACTTCGCGCCGG
ACCTGTCGCGCTTCCGGCCGCAGCTCTTCTACTGGATCTTCATCCCCTTCGACGTCGTCTGCCTCATCCTGCAGG
CCGTGGGCGGCGCGCTGTCGACGCGGTCGGGCGGGCGCAACCAGGCGGGCGTCAACGTGTCCATGGCCGGGCTGG
CGCTGCAGGTCATCATCCTGACGGCCTTCATCGCCGTCTTCGCCGACTACATGGTGCGCTACCTGCGCTCGGGCC
GGCTGTCGGGCTTCGGCTGGCGCCTCAACGGCTTCTTCCTCGGCCTGACGGCCGCCATCCTGCTGATCCTGGCCC
GCTGCGCCTACCGCGTGGCCGAGCTGCGCGACGGCTACCACGGCGCCCTGATCCGCGAGGAGGTGCCGTTCATCG
TGCTCGAGGGCGTCTTCATCGTCCTGGCCGGCTTCGCCCTGTGCCTCGGCCACCCGGGCCTGGTCTTTGGCCGCG
GCGTCGCCCGCAAGGGCTCCGGCGCCGAGTGGGAGGGGAGCGAGAGCGGCACGGGCACGGGCACGCCGGAGCGCA
AGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail