Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4359
Gene name
LocationContig_2224:73..1690
Strand+
Gene length (bp)1617
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 9.7E-70 47 289
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 6.1E-08 313 381

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 17 538 2.0E-156
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 17 538 2.0E-156
sp|Q6FT92|PRM10_CANGA Pheromone-regulated membrane protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G04433g PE=3 SV=1 16 538 4.0E-149
sp|Q9UVG5|PRM10_PICSO Pheromone-regulated membrane protein 10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=GNLVRS01_PISO0A10120g PE=3 SV=2 28 538 3.0E-148
sp|A6ZQL9|PRM10_YEAS7 Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRM10 PE=3 SV=1 18 538 4.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 17 538 2.0E-156
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 17 538 2.0E-156
sp|Q6FT92|PRM10_CANGA Pheromone-regulated membrane protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G04433g PE=3 SV=1 16 538 4.0E-149
sp|Q9UVG5|PRM10_PICSO Pheromone-regulated membrane protein 10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=GNLVRS01_PISO0A10120g PE=3 SV=2 28 538 3.0E-148
sp|A6ZQL9|PRM10_YEAS7 Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRM10 PE=3 SV=1 18 538 4.0E-143
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 29 384 5.0E-140
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 8 382 2.0E-136
sp|Q754J7|PRM10_ASHGO Pheromone-regulated membrane protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR075C PE=3 SV=1 26 380 8.0E-131
sp|Q6C4Q0|PRM10_YARLI Pheromone-regulated membrane protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E24651g PE=3 SV=1 32 538 2.0E-128
sp|C5E109|PRM10_ZYGRC Pheromone-regulated membrane protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0G17116g PE=3 SV=1 31 380 2.0E-127
sp|Q6CLI2|PRM10_KLULA Pheromone-regulated membrane protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F02816g PE=3 SV=1 33 380 1.0E-121
sp|P42946|PRM10_YEAST Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRM10 PE=1 SV=1 89 537 8.0E-98
sp|P87293|YDN1_SCHPO Uncharacterized UPF0442 protein C16A10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.01 PE=3 SV=1 29 380 3.0E-87
sp|P42947|YJK7_YEAST Uncharacterized UPF0442 protein YJL107C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL107C PE=1 SV=1 18 82 5.0E-22
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 438 538 4.0E-19
sp|Q754J7|PRM10_ASHGO Pheromone-regulated membrane protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR075C PE=3 SV=1 438 538 3.0E-18
sp|Q6CLI2|PRM10_KLULA Pheromone-regulated membrane protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F02816g PE=3 SV=1 443 538 3.0E-18
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 438 538 4.0E-18
sp|C5E109|PRM10_ZYGRC Pheromone-regulated membrane protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0G17116g PE=3 SV=1 438 538 5.0E-17
sp|P87293|YDN1_SCHPO Uncharacterized UPF0442 protein C16A10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.01 PE=3 SV=1 446 535 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 179 196 17
2 203 225 22
3 235 257 22
4 270 292 22
5 307 329 22
6 503 525 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4359
MFAAPGGAGEINDQWAEKIKKDKQPKSKKEQIRITVHIAGIISRHRYLLKLCRALMMYGAPTHRLEEYMTMSSRV
LEIEGQFLYIPSCMLVSFDDSTTHTTEVKVVRVSQGVDLGKLRDVHNIYKDVVHDKLGVEEATRRLDEVMQRRPK
FHTWLRVPVYGVASACVAPFAFEGRFIDLPIAFLLGCIVGLLQLVFAPSNELYAHVFEVSAAVITSFLARGFGSI
QQGDLFCFSALAQSSIALILPGYMVLCSSLELQSHNIVAGSVRMVHAMIYTLFLGYGITIGASLYGMMDKNAASE
THCRNPLSRPWYFIFVPGFTLCLCIINQAKWRQTPVMTVMALAGFCVNSYCSQYFEQNTQISNMLGALTVGILAN
LYSRLGRHVENFWLDVVEWWQFRMRPRFTRKKPAGAEAWSAPSVSDPESRPASPEKPPRQPRKVGDSLAAAAMLP
AIFVQVPSGLAAGGSLLAGVTSANALNGNATAAANAVDTGVRMGSLDGTAFNVLFSVIQVAIGISVGLFMSALIV
YPLGKRRSGLFSF*
Coding >Hirsu2|4359
ATGTTCGCCGCGCCCGGCGGCGCCGGCGAGATCAACGACCAGTGGGCCGAGAAGATCAAGAAGGACAAGCAGCCC
AAGTCGAAGAAGGAGCAGATCCGCATCACCGTCCACATCGCCGGCATCATCTCGCGCCACCGCTACCTGCTCAAG
CTGTGCCGCGCCCTGATGATGTACGGCGCCCCGACGCACCGGCTCGAGGAGTACATGACCATGTCGTCGCGCGTG
CTCGAGATCGAGGGCCAGTTCCTCTACATCCCCTCGTGCATGCTCGTCAGCTTCGACGACAGCACCACGCACACG
ACCGAGGTCAAGGTCGTGCGCGTCTCCCAGGGCGTCGACCTCGGCAAGCTGCGCGACGTGCACAACATCTACAAG
GATGTCGTCCACGACAAGCTGGGCGTCGAGGAGGCGACGCGCCGCCTGGACGAGGTGATGCAGCGCCGGCCCAAG
TTCCACACCTGGCTGCGCGTGCCCGTCTACGGCGTCGCCTCGGCCTGCGTCGCCCCCTTCGCCTTCGAGGGCCGC
TTCATCGACCTGCCCATCGCCTTCCTGCTCGGCTGCATCGTCGGCCTGCTCCAGCTCGTCTTCGCGCCGAGCAAC
GAGCTGTACGCCCACGTCTTCGAGGTCTCGGCCGCCGTCATCACCAGCTTCCTCGCCCGCGGCTTCGGCTCCATC
CAGCAGGGCGACCTCTTCTGCTTCAGCGCGCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCCGGCTACATGGTC
CTGTGCAGCTCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTGCGCATGGTGCACGCCATGATCTAC
ACCCTCTTCCTCGGCTACGGCATCACCATCGGCGCCTCGCTCTACGGCATGATGGACAAGAACGCGGCGAGCGAG
ACGCACTGCCGGAACCCGCTCTCGCGCCCCTGGTACTTCATCTTCGTCCCCGGCTTCACCCTGTGCCTGTGCATC
ATCAACCAGGCCAAGTGGCGGCAGACGCCCGTCATGACCGTCATGGCCCTCGCCGGCTTCTGCGTCAACAGCTAC
TGCAGCCAGTACTTTGAGCAGAACACGCAGATCTCCAACATGCTGGGCGCCCTGACCGTCGGCATCCTGGCCAAC
CTGTACTCGCGCCTGGGCCGGCACGTCGAGAACTTTTGGCTCGACGTGGTGGAGTGGTGGCAGTTCCGGATGCGG
CCGCGCTTCACGCGCAAGAAGCCCGCCGGCGCCGAGGCGTGGTCGGCGCCGTCCGTGTCGGACCCGGAGTCGCGG
CCGGCGTCGCCCGAGAAGCCGCCGCGCCAGCCGCGCAAGGTCGGCGACAGCCTGGCCGCCGCCGCCATGCTGCCG
GCCATCTTCGTGCAGGTGCCGTCCGGCCTCGCCGCCGGCGGCTCCCTGCTGGCCGGCGTCACGTCGGCCAACGCG
CTCAACGGCAACGCCACGGCCGCCGCCAACGCCGTCGACACGGGCGTCAGGATGGGCAGCCTGGACGGCACCGCC
TTCAACGTGCTGTTCAGCGTCATCCAGGTGGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCACTGATCGTC
TACCCGCTGGGCAAGAGACGGAGCGGCCTGTTCAGCTTCTAG
Transcript >Hirsu2|4359
ATGTTCGCCGCGCCCGGCGGCGCCGGCGAGATCAACGACCAGTGGGCCGAGAAGATCAAGAAGGACAAGCAGCCC
AAGTCGAAGAAGGAGCAGATCCGCATCACCGTCCACATCGCCGGCATCATCTCGCGCCACCGCTACCTGCTCAAG
CTGTGCCGCGCCCTGATGATGTACGGCGCCCCGACGCACCGGCTCGAGGAGTACATGACCATGTCGTCGCGCGTG
CTCGAGATCGAGGGCCAGTTCCTCTACATCCCCTCGTGCATGCTCGTCAGCTTCGACGACAGCACCACGCACACG
ACCGAGGTCAAGGTCGTGCGCGTCTCCCAGGGCGTCGACCTCGGCAAGCTGCGCGACGTGCACAACATCTACAAG
GATGTCGTCCACGACAAGCTGGGCGTCGAGGAGGCGACGCGCCGCCTGGACGAGGTGATGCAGCGCCGGCCCAAG
TTCCACACCTGGCTGCGCGTGCCCGTCTACGGCGTCGCCTCGGCCTGCGTCGCCCCCTTCGCCTTCGAGGGCCGC
TTCATCGACCTGCCCATCGCCTTCCTGCTCGGCTGCATCGTCGGCCTGCTCCAGCTCGTCTTCGCGCCGAGCAAC
GAGCTGTACGCCCACGTCTTCGAGGTCTCGGCCGCCGTCATCACCAGCTTCCTCGCCCGCGGCTTCGGCTCCATC
CAGCAGGGCGACCTCTTCTGCTTCAGCGCGCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCCGGCTACATGGTC
CTGTGCAGCTCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTGCGCATGGTGCACGCCATGATCTAC
ACCCTCTTCCTCGGCTACGGCATCACCATCGGCGCCTCGCTCTACGGCATGATGGACAAGAACGCGGCGAGCGAG
ACGCACTGCCGGAACCCGCTCTCGCGCCCCTGGTACTTCATCTTCGTCCCCGGCTTCACCCTGTGCCTGTGCATC
ATCAACCAGGCCAAGTGGCGGCAGACGCCCGTCATGACCGTCATGGCCCTCGCCGGCTTCTGCGTCAACAGCTAC
TGCAGCCAGTACTTTGAGCAGAACACGCAGATCTCCAACATGCTGGGCGCCCTGACCGTCGGCATCCTGGCCAAC
CTGTACTCGCGCCTGGGCCGGCACGTCGAGAACTTTTGGCTCGACGTGGTGGAGTGGTGGCAGTTCCGGATGCGG
CCGCGCTTCACGCGCAAGAAGCCCGCCGGCGCCGAGGCGTGGTCGGCGCCGTCCGTGTCGGACCCGGAGTCGCGG
CCGGCGTCGCCCGAGAAGCCGCCGCGCCAGCCGCGCAAGGTCGGCGACAGCCTGGCCGCCGCCGCCATGCTGCCG
GCCATCTTCGTGCAGGTGCCGTCCGGCCTCGCCGCCGGCGGCTCCCTGCTGGCCGGCGTCACGTCGGCCAACGCG
CTCAACGGCAACGCCACGGCCGCCGCCAACGCCGTCGACACGGGCGTCAGGATGGGCAGCCTGGACGGCACCGCC
TTCAACGTGCTGTTCAGCGTCATCCAGGTGGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCACTGATCGTC
TACCCGCTGGGCAAGAGACGGAGCGGCCTGTTCAGCTTCTAG
Gene >Hirsu2|4359
ATGTTCGCCGCGCCCGGCGGCGCCGGCGAGATCAACGACCAGTGGGCCGAGAAGATCAAGAAGGACAAGCAGCCC
AAGTCGAAGAAGGAGCAGATCCGCATCACCGTCCACATCGCCGGCATCATCTCGCGCCACCGCTACCTGCTCAAG
CTGTGCCGCGCCCTGATGATGTACGGCGCCCCGACGCACCGGCTCGAGGAGTACATGACCATGTCGTCGCGCGTG
CTCGAGATCGAGGGCCAGTTCCTCTACATCCCCTCGTGCATGCTCGTCAGCTTCGACGACAGCACCACGCACACG
ACCGAGGTCAAGGTCGTGCGCGTCTCCCAGGGCGTCGACCTCGGCAAGCTGCGCGACGTGCACAACATCTACAAG
GATGTCGTCCACGACAAGCTGGGCGTCGAGGAGGCGACGCGCCGCCTGGACGAGGTGATGCAGCGCCGGCCCAAG
TTCCACACCTGGCTGCGCGTGCCCGTCTACGGCGTCGCCTCGGCCTGCGTCGCCCCCTTCGCCTTCGAGGGCCGC
TTCATCGACCTGCCCATCGCCTTCCTGCTCGGCTGCATCGTCGGCCTGCTCCAGCTCGTCTTCGCGCCGAGCAAC
GAGCTGTACGCCCACGTCTTCGAGGTCTCGGCCGCCGTCATCACCAGCTTCCTCGCCCGCGGCTTCGGCTCCATC
CAGCAGGGCGACCTCTTCTGCTTCAGCGCGCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCCGGCTACATGGTC
CTGTGCAGCTCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTGCGCATGGTGCACGCCATGATCTAC
ACCCTCTTCCTCGGCTACGGCATCACCATCGGCGCCTCGCTCTACGGCATGATGGACAAGAACGCGGCGAGCGAG
ACGCACTGCCGGAACCCGCTCTCGCGCCCCTGGTACTTCATCTTCGTCCCCGGCTTCACCCTGTGCCTGTGCATC
ATCAACCAGGCCAAGTGGCGGCAGACGCCCGTCATGACCGTCATGGCCCTCGCCGGCTTCTGCGTCAACAGCTAC
TGCAGCCAGTACTTTGAGCAGAACACGCAGATCTCCAACATGCTGGGCGCCCTGACCGTCGGCATCCTGGCCAAC
CTGTACTCGCGCCTGGGCCGGCACGTCGAGAACTTTTGGCTCGACGTGGTGGAGTGGTGGCAGTTCCGGATGCGG
CCGCGCTTCACGCGCAAGAAGCCCGCCGGCGCCGAGGCGTGGTCGGCGCCGTCCGTGTCGGACCCGGAGTCGCGG
CCGGCGTCGCCCGAGAAGCCGCCGCGCCAGCCGCGCAAGGTCGGCGACAGCCTGGCCGCCGCCGCCATGCTGCCG
GCCATCTTCGTGCAGGTGCCGTCCGGCCTCGCCGCCGGCGGCTCCCTGCTGGCCGGCGTCACGTCGGCCAACGCG
CTCAACGGCAACGCCACGGCCGCCGCCAACGCCGTCGACACGGGCGTCAGGATGGGCAGCCTGGACGGCACCGCC
TTCAACGTGCTGTTCAGCGTCATCCAGGTGGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCACTGATCGTC
TACCCGCTGGGCAAGAGACGGAGCGGCCTGTTCAGCTTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail