Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4358
Gene name
LocationContig_2222:1277..2439
Strand-
Gene length (bp)1162
Transcript length (bp)657
Coding sequence length (bp)657
Protein length (aa) 219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07910 Peptidase_C78 Peptidase family C78 2.0E-41 39 208

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q3T9Z9|ZUFSP_MOUSE Zinc finger with UFM1-specific peptidase domain protein OS=Mus musculus GN=Zufsp PE=2 SV=2 19 210 2.0E-15
sp|Q5U2S3|ZUFSP_RAT Zinc finger with UFM1-specific peptidase domain protein OS=Rattus norvegicus GN=Zufsp PE=2 SV=1 45 178 5.0E-15
sp|Q4R4A2|ZUFSP_MACFA Zinc finger with UFM1-specific peptidase domain protein OS=Macaca fascicularis GN=ZUFSP PE=2 SV=1 45 210 6.0E-15
sp|Q3SWY8|ZUFSP_BOVIN Zinc finger with UFM1-specific peptidase domain protein OS=Bos taurus GN=ZUFSP PE=2 SV=1 45 210 8.0E-15
sp|Q96AP4|ZUFSP_HUMAN Zinc finger with UFM1-specific peptidase domain protein OS=Homo sapiens GN=ZUFSP PE=1 SV=1 45 210 1.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4358
MCSTGVVPVLEHLLEHCPLTKMAYLCHPCVQHVSKLRREDALFELIELAWDKGFNPHCRLETGGIRGTRKFIGTP
EAQALFSSLNISCAVYAFRHAERGRASCCMLQAVEEYFQKGWNGSDGAKIRPTSLPPVYLQHQGHSVTIVGFERQ
WDNQVNVLVFDPTHPDLHGIKKLVGKEIREAMPAAIALLESYRRGSKYLRKHDEFEILCLGCDDITFS*
Coding >Hirsu2|4358
ATGTGTTCGACAGGTGTTGTGCCTGTTCTGGAACACCTTTTGGAGCATTGTCCCTTGACAAAGATGGCGTATCTC
TGTCATCCTTGTGTGCAGCACGTCTCCAAATTGCGTCGCGAAGACGCTCTTTTCGAACTTATCGAGTTAGCGTGG
GACAAGGGCTTCAACCCTCATTGTCGTCTAGAGACGGGTGGCATTAGAGGAACCCGCAAATTCATCGGAACACCC
GAGGCCCAAGCGTTGTTTAGCAGCCTCAACATCTCATGTGCTGTCTATGCGTTTCGGCATGCAGAGCGCGGGCGA
GCAAGCTGCTGCATGCTACAGGCAGTGGAAGAGTATTTTCAAAAAGGTTGGAACGGAAGCGATGGCGCTAAAATT
CGCCCGACTTCGCTTCCACCGGTGTACTTGCAACATCAAGGACATTCAGTCACAATTGTCGGCTTTGAGCGACAG
TGGGACAACCAGGTAAATGTTCTGGTCTTCGACCCGACTCACCCAGATCTGCACGGCATCAAAAAACTGGTTGGG
AAGGAGATTCGTGAGGCCATGCCAGCGGCGATCGCGTTGTTGGAGTCGTACCGTCGCGGATCAAAGTACCTTCGC
AAGCACGACGAGTTTGAGATTCTCTGTCTCGGTTGCGATGATATAACCTTTTCATGA
Transcript >Hirsu2|4358
ATGTGTTCGACAGGTGTTGTGCCTGTTCTGGAACACCTTTTGGAGCATTGTCCCTTGACAAAGATGGCGTATCTC
TGTCATCCTTGTGTGCAGCACGTCTCCAAATTGCGTCGCGAAGACGCTCTTTTCGAACTTATCGAGTTAGCGTGG
GACAAGGGCTTCAACCCTCATTGTCGTCTAGAGACGGGTGGCATTAGAGGAACCCGCAAATTCATCGGAACACCC
GAGGCCCAAGCGTTGTTTAGCAGCCTCAACATCTCATGTGCTGTCTATGCGTTTCGGCATGCAGAGCGCGGGCGA
GCAAGCTGCTGCATGCTACAGGCAGTGGAAGAGTATTTTCAAAAAGGTTGGAACGGAAGCGATGGCGCTAAAATT
CGCCCGACTTCGCTTCCACCGGTGTACTTGCAACATCAAGGACATTCAGTCACAATTGTCGGCTTTGAGCGACAG
TGGGACAACCAGGTAAATGTTCTGGTCTTCGACCCGACTCACCCAGATCTGCACGGCATCAAAAAACTGGTTGGG
AAGGAGATTCGTGAGGCCATGCCAGCGGCGATCGCGTTGTTGGAGTCGTACCGTCGCGGATCAAAGTACCTTCGC
AAGCACGACGAGTTTGAGATTCTCTGTCTCGGTTGCGATGATATAACCTTTTCATGA
Gene >Hirsu2|4358
ATGTGTTCGACAGGTGAGCCAAAAGCACCAATAGTCCCGCGTCCTTGCCCAAGAGCCCGGTGCTCAGAATTGCAG
GTGTTGTGCCTGTTCTGGAACACCTTTTGGAGCATTGTCCCTTGACAAAGATGGCGTATCTCTGTCATCCTTGTG
TGCAGCACGTCTCCAAATTGCGTCGCGAAGGTAAGCGTATTGATCAGTCTTTGCATCAACCTGATTTCCTTGAGC
AGCTCAACCGCTGTCAGAATGACTGCCACGTCTCACTCCTTTTCCCTGGATGATAGGGGCATTCTGCGGCTATCG
CAACATCCAGACGCTCTTTTCGTACGTACTCGGTGCCCACCGTAAGGGATCAGAGCAATTCGAGAATCGGCTACC
GAGCATCTTCGAAATCCAGGAACTTATCGAGTTAGCGTGGGACAAGGGCTTCAACCCTCATTGTCGTCTAGAGAC
GGGTGGCATTAGAGGAACCCGCAAATTCATCGGAACACCCGAGGTACACTCGACTCTCCACGCCATCGAAGAGCA
GTCGTCTCATTGACGCCTATCTCATCATAGGCCCAAGCGTTGTTTAGCAGCCTCAACATCTCGTACGTTCACATT
GTCACCAACGGGCGGCGGCTGACTAATTAAGGCCGGCCATAGATGTGCTGTCTATGCGTTTCGGCATGCAGAGCG
CGGGCGAGCAAGCTGCTGCATGCTACAGGCAGTGGAAGAGTATTTTCAAAAAGGTTGGAACGGAAGCGATGGCGC
TAAAATTCGCCCGACTTCGCTTCCACCGGTGTACTTGCAACATCAAGGTGAGAGCCCACAGACGACATCCGTTTA
CACGAGCGCTGATCCCAGGTGCTCATTTAAGGACATTCAGTCACAATTGTCGGCTTTGAGCGACAGTGGGACAAC
CAGGTAAATGTTCTGGTCTTCGACCCGACTCACCCAGATCTGCACGGCATCAAAAAACTGGTTGGGAAGGAGATT
CGTGAGGCCATGCCAGCGGCGATCGCGTTGTTGGAGTCGTACCGTCGCGGATCAAAGTACCTTCGCAAGCACGAC
GAGTTTGAGATTCTCTGGTAAGATTCTAGCCAAAGCACAATGTCGTACGGGGTCAGACTAATACAGCAAACGACA
TGAAAGTCTCGGTTGCGATGATATAACCTTTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail