Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4357
Gene name
LocationContig_2222:227..1021
Strand+
Gene length (bp)794
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01725 Ham1p_like Ham1 family 2.2E-29 30 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YTE3|ITPA_NECH7 Inosine triphosphate pyrophosphatase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_105230 PE=3 SV=1 3 129 4.0E-64
sp|Q1K4R6|ITPA_NEUCR Inosine triphosphate pyrophosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B20D17.150 PE=3 SV=1 4 129 1.0E-59
sp|A4R1J6|ITPA_MAGO7 Inosine triphosphate pyrophosphatase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_06911 PE=3 SV=1 4 129 2.0E-58
sp|B2B5Q3|ITPA_PODAN Inosine triphosphate pyrophosphatase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_5430 PE=3 SV=2 3 129 1.0E-56
sp|E3QBC5|ITPA_COLGM Inosine triphosphate pyrophosphatase OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_03307 PE=3 SV=1 4 129 2.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YTE3|ITPA_NECH7 Inosine triphosphate pyrophosphatase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_105230 PE=3 SV=1 3 129 4.0E-64
sp|Q1K4R6|ITPA_NEUCR Inosine triphosphate pyrophosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B20D17.150 PE=3 SV=1 4 129 1.0E-59
sp|A4R1J6|ITPA_MAGO7 Inosine triphosphate pyrophosphatase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_06911 PE=3 SV=1 4 129 2.0E-58
sp|B2B5Q3|ITPA_PODAN Inosine triphosphate pyrophosphatase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_5430 PE=3 SV=2 3 129 1.0E-56
sp|E3QBC5|ITPA_COLGM Inosine triphosphate pyrophosphatase OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_03307 PE=3 SV=1 4 129 2.0E-56
sp|Q2GW61|ITPA_CHAGB Inosine triphosphate pyrophosphatase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07793 PE=3 SV=1 4 129 2.0E-56
sp|D5GCI8|ITPA_TUBMM Inosine triphosphate pyrophosphatase OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00005907001 PE=3 SV=1 6 129 3.0E-50
sp|F6HS55|ITPA_VITVI Inosine triphosphate pyrophosphatase OS=Vitis vinifera GN=VIT_05s0051g00580 PE=2 SV=1 4 127 9.0E-48
sp|C0NE84|ITPA_AJECG Inosine triphosphate pyrophosphatase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_02177 PE=3 SV=2 1 129 9.0E-48
sp|B6TNW8|ITPA_MAIZE Inosine triphosphate pyrophosphatase OS=Zea mays PE=2 SV=1 4 127 3.0E-47
sp|Q8L968|ITPA_ARATH Inosine triphosphate pyrophosphatase OS=Arabidopsis thaliana GN=At4g13720 PE=2 SV=1 4 127 4.0E-47
sp|C5WZH0|ITPA_SORBI Inosine triphosphate pyrophosphatase OS=Sorghum bicolor GN=Sb01g020160 PE=2 SV=1 4 127 8.0E-47
sp|C8V9B7|ITPA_EMENI Inosine triphosphate pyrophosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN8861 PE=3 SV=1 1 129 2.0E-46
sp|B8BH95|ITPA_ORYSI Inosine triphosphate pyrophosphatase OS=Oryza sativa subsp. indica GN=OsI_33887 PE=3 SV=1 4 127 8.0E-46
sp|Q7XDP2|ITPA_ORYSJ Inosine triphosphate pyrophosphatase OS=Oryza sativa subsp. japonica GN=Os10g0457500 PE=2 SV=2 4 127 1.0E-45
sp|Q4WTN9|ITPA_ASPFU Inosine triphosphate pyrophosphatase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_5G05560 PE=3 SV=1 2 129 3.0E-45
sp|Q0UFP3|ITPA_PHANO Inosine triphosphate pyrophosphatase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_09421 PE=3 SV=2 4 129 1.0E-44
sp|A9VE54|ITPA_MONBE Inosine triphosphate pyrophosphatase OS=Monosiga brevicollis GN=13033 PE=3 SV=1 4 127 7.0E-44
sp|Q2TX99|ITPA_ASPOR Inosine triphosphate pyrophosphatase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090010000228 PE=3 SV=1 4 127 7.0E-43
sp|Q7Q4F5|ITPA_ANOGA Inosine triphosphate pyrophosphatase OS=Anopheles gambiae GN=AGAP008374 PE=3 SV=2 4 127 3.0E-42
sp|C1FI13|ITPA_MICSR Inosine triphosphate pyrophosphatase OS=Micromonas sp. (strain RCC299 / NOUM17) GN=MICPUN_61716 PE=3 SV=1 4 127 3.0E-42
sp|A8NZ80|ITPA_COPC7 Inosine triphosphate pyrophosphatase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_08181 PE=3 SV=2 4 124 7.0E-42
sp|Q16YB3|ITPA_AEDAE Inosine triphosphate pyrophosphatase OS=Aedes aegypti GN=AAEL008605 PE=3 SV=1 1 127 4.0E-41
sp|Q9GYG4|ITPA_CAEEL Inosine triphosphate pyrophosphatase OS=Caenorhabditis elegans GN=hap-1 PE=2 SV=1 1 127 7.0E-41
sp|A8XZP2|ITPA_CAEBR Inosine triphosphate pyrophosphatase OS=Caenorhabditis briggsae GN=hap-1 PE=3 SV=1 1 127 7.0E-41
sp|D0MY11|ITPA_PHYIT Inosine triphosphate pyrophosphatase OS=Phytophthora infestans (strain T30-4) GN=PITG_03601 PE=3 SV=1 4 127 2.0E-40
sp|B0XL39|ITPA_CULQU Inosine triphosphate pyrophosphatase OS=Culex quinquefasciatus GN=CPIJ019949 PE=3 SV=1 4 127 4.0E-40
sp|Q54LQ6|ITPA_DICDI Inosine triphosphate pyrophosphatase OS=Dictyostelium discoideum GN=itpa PE=3 SV=1 3 127 5.0E-40
sp|D3ZW55|ITPA_RAT Inosine triphosphate pyrophosphatase OS=Rattus norvegicus GN=Itpa PE=3 SV=1 3 127 9.0E-40
sp|Q9VMW7|ITPA_DROME Inosine triphosphate pyrophosphatase OS=Drosophila melanogaster GN=CG8891 PE=2 SV=1 4 127 1.0E-39
sp|Q6CDL9|ITPA_YARLI Inosine triphosphate pyrophosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAM1 PE=3 SV=1 2 129 4.0E-39
sp|E3KAB5|ITPA_PUCGT Inosine triphosphate pyrophosphatase OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_06893 PE=3 SV=1 2 127 8.0E-39
sp|Q9D892|ITPA_MOUSE Inosine triphosphate pyrophosphatase OS=Mus musculus GN=Itpa PE=1 SV=2 3 127 8.0E-39
sp|E0VVF6|ITPA_PEDHC Inosine triphosphate pyrophosphatase OS=Pediculus humanus subsp. corporis GN=Phum_PHUM462900 PE=3 SV=1 4 123 9.0E-39
sp|Q9BY32|ITPA_HUMAN Inosine triphosphate pyrophosphatase OS=Homo sapiens GN=ITPA PE=1 SV=2 3 127 1.0E-38
sp|Q4PD06|ITPA_USTMA Inosine triphosphate pyrophosphatase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_02007 PE=3 SV=1 4 127 2.0E-38
sp|Q2NLA8|ITPA_XENLA Inosine triphosphate pyrophosphatase OS=Xenopus laevis GN=itpa PE=2 SV=1 4 127 2.0E-38
sp|A3LVK6|ITPA_PICST Inosine triphosphate pyrophosphatase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAM1 PE=3 SV=1 1 127 5.0E-38
sp|F4P9L8|ITPA_BATDJ Inosine triphosphate pyrophosphatase OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_13412 PE=3 SV=1 1 124 6.0E-38
sp|F1NLH9|ITPA_CHICK Inosine triphosphate pyrophosphatase OS=Gallus gallus GN=ITPA PE=3 SV=2 4 127 7.0E-38
sp|Q2KIC5|ITPA_BOVIN Inosine triphosphate pyrophosphatase OS=Bos taurus GN=ITPA PE=2 SV=1 3 127 1.0E-37
sp|F6Y089|ITPA_CIOIN Inosine triphosphate pyrophosphatase OS=Ciona intestinalis PE=3 SV=1 4 127 1.0E-37
sp|A7RWC9|ITPA_NEMVE Inosine triphosphate pyrophosphatase OS=Nematostella vectensis GN=v1g163483 PE=3 SV=1 4 127 1.0E-36
sp|Q5KPF3|ITPA_CRYNJ Inosine triphosphate pyrophosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA03000 PE=3 SV=1 1 124 1.0E-36
sp|C4YRQ5|ITPA_CANAW Inosine triphosphate pyrophosphatase OS=Candida albicans (strain WO-1) GN=HAM1 PE=3 SV=1 1 124 3.0E-36
sp|Q59N80|ITPA_CANAL Inosine triphosphate pyrophosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAM1 PE=3 SV=1 1 124 3.0E-36
sp|A5WVX0|ITPA_DANRE Inosine triphosphate pyrophosphatase OS=Danio rerio GN=itpa PE=2 SV=1 4 127 1.0E-35
sp|Q6BIT7|ITPA_DEBHA Inosine triphosphate pyrophosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAM1 PE=3 SV=1 4 127 1.0E-35
sp|Q9UU89|ITPA_SCHPO Inosine triphosphate pyrophosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC830.10 PE=3 SV=1 4 127 2.0E-34
sp|Q4DRX4|ITPA2_TRYCC Inosine triphosphate pyrophosphatase 2 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053508307.184 PE=3 SV=1 3 124 1.0E-32
sp|Q4DBX5|ITPA1_TRYCC Inosine triphosphate pyrophosphatase 1 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053504103.6 PE=3 SV=1 3 124 8.0E-32
sp|Q6FUV2|ITPA_CANGA Inosine triphosphate pyrophosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAM1 PE=3 SV=1 2 128 2.0E-28
sp|A8BKZ6|ITPA_GIAIC Inosine triphosphate pyrophosphatase OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_7511 PE=3 SV=2 30 124 7.0E-28
sp|Q752Z9|ITPA_ASHGO Inosine triphosphate pyrophosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAM1 PE=3 SV=1 1 127 2.0E-26
sp|P47119|ITPA_YEAST Inosine triphosphate pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAM1 PE=1 SV=1 3 124 3.0E-26
sp|Q6CV82|ITPA_KLULA Inosine triphosphate pyrophosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAM1 PE=3 SV=1 3 124 1.0E-23
sp|Q8PZ91|NTPA_METMA Non-canonical purine NTP pyrophosphatase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0603 PE=3 SV=1 1 129 2.0E-19
sp|Q8TV07|NTPA_METKA Non-canonical purine NTP pyrophosphatase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK1594 PE=3 SV=1 2 127 3.0E-19
sp|Q8IBP3|ITPA_PLAF7 Inosine triphosphate pyrophosphatase OS=Plasmodium falciparum (isolate 3D7) GN=MAL7P1.110 PE=3 SV=1 15 124 4.0E-19
sp|Q8TJS1|NTPA_METAC Non-canonical purine NTP pyrophosphatase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_3706 PE=3 SV=1 1 129 4.0E-18
sp|D9PYS9|NTPA_METTM Non-canonical purine NTP pyrophosphatase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c00120 PE=3 SV=1 2 127 5.0E-17
sp|Q4Q0V1|ITPA_LEIMA Inosine triphosphate pyrophosphatase OS=Leishmania major GN=LMJF_36_4630 PE=3 SV=1 3 129 7.0E-16
sp|Q5JEX8|NTPA_THEKO Non-canonical purine NTP pyrophosphatase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK2111 PE=3 SV=1 2 127 4.0E-15
sp|Q9HLA4|NTPA_THEAC Non-canonical purine NTP pyrophosphatase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0325 PE=3 SV=1 6 127 5.0E-14
sp|Q8ZVB5|NTPA_PYRAE Non-canonical purine NTP pyrophosphatase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE2365 PE=3 SV=1 2 129 1.0E-13
sp|A8A8W1|NTPA_IGNH4 Non-canonical purine NTP pyrophosphatase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0179 PE=3 SV=1 3 123 3.0E-13
sp|A2BJY7|NTPA_HYPBU Non-canonical purine NTP pyrophosphatase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=Hbut_0432 PE=3 SV=1 4 129 6.0E-12
sp|B1L6T7|NTPA_KORCO Non-canonical purine NTP pyrophosphatase OS=Korarchaeum cryptofilum (strain OPF8) GN=Kcr_1420 PE=3 SV=1 4 123 2.0E-11
sp|Q8U446|NTPA_PYRFU Non-canonical purine NTP pyrophosphatase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0249 PE=3 SV=1 2 123 1.0E-10
sp|Q57679|NTPA_METJA Non-canonical purine NTP pyrophosphatase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0226 PE=1 SV=2 2 129 2.0E-10
sp|Q8SS24|ITPA_ENCCU Inosine triphosphate pyrophosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_1180 PE=3 SV=1 1 123 2.0E-10
sp|Q6AQD7|NTPA_DESPS Non-canonical purine NTP pyrophosphatase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=DP0707 PE=3 SV=1 27 125 5.0E-10
sp|E0S6S0|ITPA_ENCIT Inosine triphosphate pyrophosphatase OS=Encephalitozoon intestinalis (strain ATCC 50506) GN=Eint_041160 PE=3 SV=1 3 119 7.0E-10
sp|Q64MG2|NTPA_BACFR Non-canonical purine NTP pyrophosphatase OS=Bacteroides fragilis (strain YCH46) GN=BF4588 PE=3 SV=1 3 127 1.0E-09
sp|Q8A327|NTPA_BACTN Non-canonical purine NTP pyrophosphatase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=BT_3128 PE=3 SV=1 3 127 2.0E-09
sp|Q2RN61|NTPA_RHORT Non-canonical purine NTP pyrophosphatase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A3640 PE=3 SV=1 24 127 3.0E-09
sp|Q8DHZ6|NTPA_THEEB Non-canonical purine NTP pyrophosphatase OS=Thermosynechococcus elongatus (strain BP-1) GN=tll1797 PE=3 SV=1 1 123 1.0E-08
sp|Q97ZZ0|NTPA_SULSO Non-canonical purine NTP pyrophosphatase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0432 PE=3 SV=1 2 129 1.0E-08
sp|P74432|NTPA_SYNY3 Non-canonical purine NTP pyrophosphatase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0402 PE=3 SV=1 1 123 2.0E-08
sp|O59580|NTPA_PYRHO Non-canonical purine NTP pyrophosphatase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1917 PE=1 SV=1 2 127 7.0E-08
sp|Q8XXF4|NTPA_RALSO Non-canonical purine NTP pyrophosphatase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2160 PE=3 SV=1 1 123 2.0E-07
sp|Q67SL4|NTPA_SYMTH Non-canonical purine NTP pyrophosphatase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH344 PE=3 SV=1 24 129 2.0E-07
sp|Q7NN81|NTPA_GLOVI Non-canonical purine NTP pyrophosphatase OS=Gloeobacter violaceus (strain PCC 7421) GN=glr0532 PE=3 SV=1 40 123 9.0E-07
sp|A1WQF4|NTPA_VEREI Non-canonical purine NTP pyrophosphatase OS=Verminephrobacter eiseniae (strain EF01-2) GN=Veis_4156 PE=3 SV=1 2 127 1.0E-06
sp|Q7U9M0|NTPA_SYNPX Non-canonical purine NTP pyrophosphatase OS=Synechococcus sp. (strain WH8102) GN=SYNW0234 PE=3 SV=1 1 124 2.0E-06
sp|Q666N1|NTPA_YERPS Non-canonical purine NTP pyrophosphatase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB3217 PE=3 SV=1 1 123 3.0E-06
sp|B1ZXD5|NTPA_OPITP Non-canonical purine NTP pyrophosphatase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=Oter_3653 PE=3 SV=1 37 123 3.0E-06
sp|A1TT41|NTPA_ACIAC Non-canonical purine NTP pyrophosphatase OS=Acidovorax citrulli (strain AAC00-1) GN=Aave_3578 PE=3 SV=1 2 123 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0047429 nucleoside-triphosphate diphosphatase activity Yes
GO:0009143 nucleoside triphosphate catabolic process Yes
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0071704 organic substance metabolic process No
GO:0034404 nucleobase-containing small molecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0044248 cellular catabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0046434 organophosphate catabolic process No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:1901575 organic substance catabolic process No
GO:0044249 cellular biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009987 cellular process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0044281 small molecule metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0009056 catabolic process No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901292 nucleoside phosphate catabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0016817 hydrolase activity, acting on acid anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4357
MVRVTFVTGNAHKLHEVQSILEPLIQVETAELVNGPVLVEDTALCFNALGGLPGPYVKWFLSAIGHQGLNDLLAA
YADKSAEAVCTFGYSAGPGQKPTLFQGRCPGKIVLPRGPSHFGWDPVFEFEGRT*
Coding >Hirsu2|4357
ATGGTTCGCGTCACGTTCGTCACCGGCAATGCCCATAAATTGCATGAGGTTCAGTCCATCCTCGAACCACTAATC
CAAGTCGAGACTGCTGAATTGGTTAATGGACCTGTTCTCGTCGAGGATACCGCCCTGTGTTTCAACGCGCTTGGT
GGCCTGCCAGGTCCCTATGTCAAGTGGTTTTTGTCCGCCATTGGCCATCAAGGCCTCAACGACCTTCTTGCCGCC
TATGCGGACAAGTCCGCCGAGGCCGTTTGTACCTTTGGCTATTCCGCAGGGCCGGGCCAGAAGCCCACCCTATTC
CAGGGACGTTGCCCGGGCAAGATTGTGCTCCCGCGAGGACCGTCCCACTTCGGCTGGGATCCTGTATTCGAGTTC
GAAGGCCGCACGTGA
Transcript >Hirsu2|4357
ATGGTTCGCGTCACGTTCGTCACCGGCAATGCCCATAAATTGCATGAGGTTCAGTCCATCCTCGAACCACTAATC
CAAGTCGAGACTGCTGAATTGGTTAATGGACCTGTTCTCGTCGAGGATACCGCCCTGTGTTTCAACGCGCTTGGT
GGCCTGCCAGGTCCCTATGTCAAGTGGTTTTTGTCCGCCATTGGCCATCAAGGCCTCAACGACCTTCTTGCCGCC
TATGCGGACAAGTCCGCCGAGGCCGTTTGTACCTTTGGCTATTCCGCAGGGCCGGGCCAGAAGCCCACCCTATTC
CAGGGACGTTGCCCGGGCAAGATTGTGCTCCCGCGAGGACCGTCCCACTTCGGCTGGGATCCTGTATTCGAGTTC
GAAGGCCGCACGTGA
Gene >Hirsu2|4357
ATGGTTCGCGTCACGTTCGTCACCGGCAATGCCCATAAATTGCATGAGGTTCAGTCCATCCTCGAACCACTAATC
CAAGTCGAGAGTAAGCGGCTCGACCTCGAGGAAGTACAGGGCGCCATCGAGGATATTGCTGAGTACAAATGCCGG
AAAGCTGCTGAATTGGTGAGCCTGACTGGACTCGTCTGTCAGATGAACTTGTCGCTAGGTGTGCAAGGTCGCGCT
TACGGGAGTCCAGGTTAATGGACCTGTTCTCGTCGAGGATACCGCCCTGTGTTTCAACGCGCTTGGTGGCCTGCC
AGGTCCCTATGTGTTGGTCTGCCACCTTCCGCTCAATACTCTGCCGCTGATAAGTCGCTGCTTGGTCCCGCAAAG
CAAGTGGTTTTTGTCCGCCATTGGCCATCAAGGCCTCAACGACCTTCTTGCCGCCTATGCGGACAAGTCCGCCGA
GGCCGTTTGTACCTTTGGCTATTCCGCAGGGCCGGGCCAGAAGCCCACCCTATTCCAGGGACGTTGCCCGGTACG
CCTCCTACGCCCCTACCTTGACACTCTTGTCCCTACTCACCCGGGTGCTTAAGTGACGCGGACACCACAACCGAA
AAGAGCTGGACGACTTACGCTTACCTCGTACAGGGCAAGATTGTGCTCCCGCGAGGACCGTCCCACTTCGGTAAG
TTCTTCCGTCCGACTGCCATCAGTCGCACGCAGGCAGTGTGCGGAAAACATGTTTGTCCCCTCTAAGGCGTGGTT
CATCAGGCTGGGATCCTGTATTCGAGTTCGAAGGCCGCACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail