Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4353
Gene name
LocationContig_222:23877..25007
Strand-
Gene length (bp)1130
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 5.9E-16 12 98
PF00153 Mito_carr Mitochondrial carrier protein 4.3E-16 109 210
PF00153 Mito_carr Mitochondrial carrier protein 8.5E-17 214 298

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00319|PM47B_CANBO Peroxisomal membrane protein PMP47B OS=Candida boidinii GN=PMP47B PE=2 SV=1 11 297 7.0E-72
sp|P21245|PM47A_CANBO Peroxisomal membrane protein PMP47A OS=Candida boidinii GN=PMP47A PE=1 SV=1 11 297 7.0E-71
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 1 295 1.0E-47
sp|O04200|PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana GN=PXN PE=1 SV=1 28 297 3.0E-44
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 5 297 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00319|PM47B_CANBO Peroxisomal membrane protein PMP47B OS=Candida boidinii GN=PMP47B PE=2 SV=1 11 297 7.0E-72
sp|P21245|PM47A_CANBO Peroxisomal membrane protein PMP47A OS=Candida boidinii GN=PMP47A PE=1 SV=1 11 297 7.0E-71
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 1 295 1.0E-47
sp|O04200|PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana GN=PXN PE=1 SV=1 28 297 3.0E-44
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 5 297 2.0E-41
sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 5 297 5.0E-37
sp|Q75A82|ANT1_ASHGO Peroxisomal adenine nucleotide transporter 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ANT1 PE=3 SV=1 52 304 3.0E-30
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 17 305 3.0E-26
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 17 305 6.0E-26
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 17 305 3.0E-25
sp|Q8VZS0|PNC2_ARATH Peroxisomal adenine nucleotide carrier 2 OS=Arabidopsis thaliana GN=PNC2 PE=1 SV=1 11 297 4.0E-25
sp|Q9MA90|PNC1_ARATH Peroxisomal adenine nucleotide carrier 1 OS=Arabidopsis thaliana GN=PNC1 PE=1 SV=1 11 297 6.0E-25
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 15 304 6.0E-25
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 18 291 2.0E-23
sp|Q06497|ANT1_YEAST Peroxisomal adenine nucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANT1 PE=1 SV=1 16 297 3.0E-23
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 16 284 1.0E-22
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 7 289 3.0E-22
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 17 297 7.0E-22
sp|B6ZJZ9|PNC1_SOYBN Peroxisomal adenine nucleotide carrier 1 OS=Glycine max GN=PNC1 PE=2 SV=1 11 297 2.0E-20
sp|Q86I81|MCFI_DICDI Mitochondrial substrate carrier family protein I OS=Dictyostelium discoideum GN=mcfI PE=2 SV=1 17 297 5.0E-20
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 32 291 6.0E-20
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 7 292 2.0E-18
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 7 292 4.0E-18
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 7 292 7.0E-18
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 15 300 1.0E-17
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 4 292 2.0E-17
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 32 313 4.0E-17
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 14 297 9.0E-17
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 8 299 2.0E-16
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 7 292 2.0E-16
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 8 299 1.0E-15
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 9 304 1.0E-15
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 17 304 3.0E-15
sp|P38127|RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 52 292 5.0E-15
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 4 297 7.0E-15
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 9 307 8.0E-15
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 11 304 1.0E-14
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 17 280 1.0E-14
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 10 297 1.0E-14
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 25 296 3.0E-14
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 22 291 4.0E-14
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 114 297 1.0E-13
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 17 278 5.0E-13
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 17 300 5.0E-13
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 4 289 6.0E-13
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 9 279 7.0E-13
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 17 292 1.0E-12
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 105 291 1.0E-12
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 9 292 3.0E-12
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 18 284 3.0E-12
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 15 278 3.0E-12
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 17 278 3.0E-12
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 15 284 3.0E-12
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 107 297 4.0E-12
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 14 310 4.0E-12
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 9 279 4.0E-12
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 17 296 4.0E-12
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 17 278 5.0E-12
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 12 304 6.0E-12
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 17 278 7.0E-12
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 9 297 8.0E-12
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 14 299 9.0E-12
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 1 302 9.0E-12
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 43 289 9.0E-12
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 17 278 9.0E-12
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 10 291 1.0E-11
sp|Q9UTD6|YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.03c PE=3 SV=1 52 291 1.0E-11
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 15 284 1.0E-11
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 105 291 1.0E-11
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 52 303 2.0E-11
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 3 275 2.0E-11
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 17 304 3.0E-11
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 17 292 3.0E-11
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 15 284 3.0E-11
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 17 284 4.0E-11
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 15 284 4.0E-11
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 114 297 5.0E-11
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 15 284 5.0E-11
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 7 289 6.0E-11
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 9 292 6.0E-11
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 15 278 6.0E-11
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 18 297 6.0E-11
sp|Q9BSK2|S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 9 292 7.0E-11
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 15 284 8.0E-11
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 35 289 9.0E-11
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 114 297 9.0E-11
sp|Q74Z23|S2538_ASHGO Solute carrier family 25 member 38 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR383W PE=3 SV=1 14 304 1.0E-10
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 17 289 1.0E-10
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 15 183 1.0E-10
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 15 284 2.0E-10
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 52 300 2.0E-10
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 17 300 2.0E-10
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 17 278 2.0E-10
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 17 205 3.0E-10
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 10 189 3.0E-10
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 17 292 3.0E-10
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 17 289 3.0E-10
sp|Q1ECW7|S247A_DANRE Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 12 307 3.0E-10
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 7 213 4.0E-10
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 17 297 4.0E-10
sp|Q6DHS9|S2548_DANRE Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 17 275 4.0E-10
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 17 297 4.0E-10
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 15 316 4.0E-10
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 104 276 4.0E-10
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 12 291 4.0E-10
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 17 284 5.0E-10
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 15 306 5.0E-10
sp|Q6FTE5|TPC1_CANGA Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 16 189 5.0E-10
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 17 291 5.0E-10
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 15 300 6.0E-10
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 118 304 6.0E-10
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 17 289 6.0E-10
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 46 192 9.0E-10
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 17 297 1.0E-09
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 105 291 1.0E-09
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 18 313 1.0E-09
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 15 306 1.0E-09
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 17 300 1.0E-09
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 1 291 1.0E-09
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 3 291 1.0E-09
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 17 289 1.0E-09
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 17 289 2.0E-09
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 104 276 2.0E-09
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 118 292 2.0E-09
sp|Q3MHI3|S2548_BOVIN Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 10 297 2.0E-09
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 12 300 2.0E-09
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 19 283 2.0E-09
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 14 201 3.0E-09
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 17 292 3.0E-09
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 19 283 3.0E-09
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 31 297 3.0E-09
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 49 292 3.0E-09
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 15 289 3.0E-09
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 111 297 4.0E-09
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 18 292 4.0E-09
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 1 183 5.0E-09
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 17 304 5.0E-09
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 114 297 5.0E-09
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 8 292 7.0E-09
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 13 215 8.0E-09
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 114 297 8.0E-09
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 113 297 1.0E-08
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 15 276 1.0E-08
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 7 191 1.0E-08
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 7 191 1.0E-08
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 17 210 2.0E-08
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 110 288 2.0E-08
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 17 297 2.0E-08
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 114 297 2.0E-08
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 111 297 2.0E-08
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 49 300 2.0E-08
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 7 276 2.0E-08
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 13 276 3.0E-08
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 118 292 3.0E-08
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 15 289 3.0E-08
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 16 283 3.0E-08
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 10 282 4.0E-08
sp|Q5RD67|S2544_PONAB Solute carrier family 25 member 44 OS=Pongo abelii GN=SLC25A44 PE=2 SV=2 11 280 4.0E-08
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 18 291 4.0E-08
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 16 183 5.0E-08
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 105 292 5.0E-08
sp|A5D9W9|S2538_PICGU Solute carrier family 25 member 38 homolog OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00074 PE=3 SV=2 1 303 5.0E-08
sp|Q96H78|S2544_HUMAN Solute carrier family 25 member 44 OS=Homo sapiens GN=SLC25A44 PE=2 SV=1 11 280 5.0E-08
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 6 282 5.0E-08
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 1 291 6.0E-08
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 1 291 6.0E-08
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 46 292 6.0E-08
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 13 276 6.0E-08
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 17 297 7.0E-08
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 116 303 7.0E-08
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 12 304 9.0E-08
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 108 315 1.0E-07
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 17 304 1.0E-07
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 109 291 1.0E-07
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 17 205 1.0E-07
sp|P04710|ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 115 300 1.0E-07
sp|Q8BGF9|S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 28 280 1.0E-07
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 49 300 1.0E-07
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 15 303 1.0E-07
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 11 291 1.0E-07
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 105 292 1.0E-07
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 17 306 1.0E-07
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 114 297 1.0E-07
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 9 103 2.0E-07
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 17 291 2.0E-07
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 9 105 2.0E-07
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 105 291 2.0E-07
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 17 304 2.0E-07
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 11 294 2.0E-07
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 17 292 2.0E-07
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 107 297 3.0E-07
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 17 291 3.0E-07
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 17 282 3.0E-07
sp|Q01356|ARG13_NEUCR Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 19 297 3.0E-07
sp|Q06143|DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 19 294 3.0E-07
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 115 300 3.0E-07
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 13 276 3.0E-07
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 17 282 3.0E-07
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 19 290 3.0E-07
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 17 276 4.0E-07
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 109 291 4.0E-07
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 107 297 4.0E-07
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 7 280 4.0E-07
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 104 276 4.0E-07
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 19 283 4.0E-07
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 17 278 4.0E-07
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 46 292 4.0E-07
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 7 278 4.0E-07
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 7 292 5.0E-07
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 115 300 5.0E-07
sp|Q8WUT9|S2543_HUMAN Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 17 292 6.0E-07
sp|Q6PIV7|S2534_HUMAN Solute carrier family 25 member 34 OS=Homo sapiens GN=SLC25A34 PE=2 SV=1 19 278 6.0E-07
sp|Q9BSK2|S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 108 299 7.0E-07
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 17 208 7.0E-07
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 17 292 7.0E-07
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 101 310 8.0E-07
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 116 297 8.0E-07
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 111 303 1.0E-06
sp|A1CWA4|S2538_NEOFI Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 15 302 1.0E-06
sp|Q4WQC5|S2538_ASPFU Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12340 PE=3 SV=1 15 302 1.0E-06
sp|B0Y4J4|S2538_ASPFC Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_069300 PE=3 SV=1 15 302 1.0E-06
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 28 205 1.0E-06
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 18 291 1.0E-06
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 114 278 2.0E-06
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 18 189 2.0E-06
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 18 291 2.0E-06
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 17 283 2.0E-06
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 13 276 2.0E-06
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 101 310 2.0E-06
sp|A1CIF6|S2538_ASPCL Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 15 302 2.0E-06
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 41 188 2.0E-06
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 41 188 2.0E-06
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 108 299 3.0E-06
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 111 297 3.0E-06
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 17 304 3.0E-06
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 7 278 3.0E-06
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 110 310 3.0E-06
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 15 292 3.0E-06
sp|Q9WVD5|ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 18 291 3.0E-06
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 24 278 3.0E-06
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 17 208 4.0E-06
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 17 304 4.0E-06
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 19 283 4.0E-06
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 19 283 4.0E-06
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 109 310 5.0E-06
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 6 215 6.0E-06
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 7 278 7.0E-06
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 111 285 7.0E-06
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 12 297 8.0E-06
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 18 304 8.0E-06
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 17 292 8.0E-06
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 17 311 8.0E-06
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 14 275 8.0E-06
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 122 302 9.0E-06
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 52 292 9.0E-06
sp|Q1DRJ3|S2538_COCIM Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 15 302 1.0E-05
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 12 183 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 64 86 22
3 115 137 22
4 179 201 22
5 216 238 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4353
MASKAPIPQNDNVAHALAGAGGGILSMVLTYPLITLSTRAQVESRKAETRFIAAVQRIIAREGVAGLYSGINSAL
FGISVTNFVYYYWYEWTRSFFEKAAQTAGRAGKKLTTVESMIAGAIAGSATVIITNPIWVVNTRVTTRKQNSEAD
VEAGTRSRPRSPSTIGTLMSLLKNEGPQALFAGVIPALVLVINPILQYTLFEQMKNAVEKRRKVTPTVAFFLGAL
GKLFATSVTYPYITVKSQMHVAGHSDKKEGMSQALRRVIKEEGYSGLYKGIGPKVTQSVLTAALLFAFKDALYEQ
TVKLRTAAAARKRVGA*
Coding >Hirsu2|4353
ATGGCTTCCAAGGCGCCCATCCCCCAGAACGACAACGTCGCCCACGCCCTCGCCGGCGCCGGCGGCGGCATCTTG
TCCATGGTCCTGACCTATCCCCTCATCACGCTGTCGACGCGCGCCCAGGTCGAGTCCAGGAAGGCGGAGACGCGG
TTCATCGCGGCGGTGCAGCGCATCATCGCGCGCGAGGGCGTCGCAGGCCTGTACTCGGGCATCAACTCGGCCCTG
TTCGGCATCAGCGTCACCAACTTCGTCTACTACTACTGGTACGAGTGGACGCGCTCCTTCTTCGAAAAGGCTGCG
CAGACGGCCGGGCGGGCCGGCAAGAAGCTCACGACGGTCGAGTCCATGATCGCCGGCGCCATCGCCGGCTCCGCC
ACCGTCATCATCACCAACCCCATCTGGGTTGTCAACACGCGCGTCACCACGCGCAAGCAGAATAGCGAGGCCGAC
GTCGAGGCCGGCACCCGCTCGCGCCCCCGCTCGCCCTCCACCATCGGCACCCTGATGTCGCTGCTGAAGAACGAG
GGTCCGCAGGCGCTCTTCGCCGGCGTCATCCCGGCCCTTGTCCTCGTCATAAACCCCATTCTCCAGTACACCCTC
TTCGAGCAGATGAAGAACGCCGTCGAGAAGCGGAGGAAGGTGACGCCTACCGTCGCCTTCTTCCTCGGCGCCCTC
GGCAAGCTGTTTGCCACCTCGGTCACGTACCCGTACATCACCGTCAAGAGCCAGATGCACGTTGCCGGCCACAGC
GACAAGAAGGAGGGCATGTCCCAGGCGCTTCGGCGTGTCATCAAAGAGGAGGGCTACTCAGGCCTGTACAAGGGC
ATCGGCCCCAAGGTCACCCAGAGCGTCCTGACCGCAGCCCTCCTCTTCGCCTTCAAGGACGCACTGTACGAGCAG
ACGGTCAAGCTCCGTACGGCTGCCGCCGCCCGCAAGCGCGTTGGCGCTTGA
Transcript >Hirsu2|4353
ATGGCTTCCAAGGCGCCCATCCCCCAGAACGACAACGTCGCCCACGCCCTCGCCGGCGCCGGCGGCGGCATCTTG
TCCATGGTCCTGACCTATCCCCTCATCACGCTGTCGACGCGCGCCCAGGTCGAGTCCAGGAAGGCGGAGACGCGG
TTCATCGCGGCGGTGCAGCGCATCATCGCGCGCGAGGGCGTCGCAGGCCTGTACTCGGGCATCAACTCGGCCCTG
TTCGGCATCAGCGTCACCAACTTCGTCTACTACTACTGGTACGAGTGGACGCGCTCCTTCTTCGAAAAGGCTGCG
CAGACGGCCGGGCGGGCCGGCAAGAAGCTCACGACGGTCGAGTCCATGATCGCCGGCGCCATCGCCGGCTCCGCC
ACCGTCATCATCACCAACCCCATCTGGGTTGTCAACACGCGCGTCACCACGCGCAAGCAGAATAGCGAGGCCGAC
GTCGAGGCCGGCACCCGCTCGCGCCCCCGCTCGCCCTCCACCATCGGCACCCTGATGTCGCTGCTGAAGAACGAG
GGTCCGCAGGCGCTCTTCGCCGGCGTCATCCCGGCCCTTGTCCTCGTCATAAACCCCATTCTCCAGTACACCCTC
TTCGAGCAGATGAAGAACGCCGTCGAGAAGCGGAGGAAGGTGACGCCTACCGTCGCCTTCTTCCTCGGCGCCCTC
GGCAAGCTGTTTGCCACCTCGGTCACGTACCCGTACATCACCGTCAAGAGCCAGATGCACGTTGCCGGCCACAGC
GACAAGAAGGAGGGCATGTCCCAGGCGCTTCGGCGTGTCATCAAAGAGGAGGGCTACTCAGGCCTGTACAAGGGC
ATCGGCCCCAAGGTCACCCAGAGCGTCCTGACCGCAGCCCTCCTCTTCGCCTTCAAGGACGCACTGTACGAGCAG
ACGGTCAAGCTCCGTACGGCTGCCGCCGCCCGCAAGCGCGTTGGCGCTTGA
Gene >Hirsu2|4353
ATGGCTTCCAAGGCGCCCATCCCCCAGAACGACAACGTCGCCCACGCCCTCGCCGGCGCCGGCGGCGGCATCTTG
TCCATGGTCCTGACGTGAGCGAGCCCCCTCCCCGTCCCCCGCATCGCATGCCCTCGTTCCGGGCGTTGCCCTGCC
AGACTCGCCGGCTGACGCGCTTCGCCAGCTATCCCCTCATCACGCTGTCGACGCGCGCCCAGGTCGAGTCCAGGA
AGGCGGAGACGCGGTTCATCGCGGCGGTGCAGCGCATCATCGCGCGCGAGGGCGTCGCAGGCCTGTACTCGGGCA
TCAACTCGGCCCTGTTCGGCATCAGCGTCACCAACTTCGTCTACTACTACTGGTACGAGTGGACGCGCTCCTTCT
TCGAAAAGGCTGCGCAGACGGCCGGGCGGGCCGGCAAGAAGCTCACGACGGTCGAGTCCATGATCGCCGGCGCCA
TCGCCGGCTCCGCCACCGTCATCATCACCAACCCCATCTGGGTTGTCAACACGCGCGTCACCACGCGCAAGCAGA
ATAGCGAGGCCGACGTCGAGGCCGGCACCCGCTCGCGCCCCCGCTCGCCCTCCACCATCGGCACCCTGATGTCGC
TGCTGAAGAACGAGGGTCCGCAGGCGCTCTTCGCCGGCGTCATCCCGGCCCTTGTCCTCGTCATAAACCCCATTC
TCCAGTACACCCTCTTCGAGCAGATGAAGAACGCCGTCGAGAAGCGGAGGAAGGTGACGCCTACCGTCGCCTTCT
TCCTCGGCGCCCTCGGCAAGCTGTTTGCCACCTCGGTCACGTACCCGTACATCACCGTCAAGAGCCAGATGCACG
TTGCCGGCCACAGCGACAAGAAGGAGGGCATGTCCCAGGCGCTTCGGCGTGTCATCAAAGAGGAGGGCTACTCAG
GCCTGTACAAGGGTAAGGCGCCGAACCGGGACGTCCCGAAAGGACCCCCGTCCCCCCCGTCCTGCTCTATGCCGG
GCTCGAGCTGACATGACAATCCTCCAGGCATCGGCCCCAAGGTCACCCAGAGCGTCCTGACCGCAGCCCTCCTCT
TCGCCTTCAAGGACGCACTGTACGAGCAGACGGTCAAGCTCCGTACGGCTGCCGCCGCCCGCAAGCGCGTTGGCG
CTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail