Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4346
Gene name
LocationContig_222:12671..14781
Strand+
Gene length (bp)2110
Transcript length (bp)1773
Coding sequence length (bp)1773
Protein length (aa) 591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04820 Trp_halogenase Tryptophan halogenase 1.3E-14 9 85
PF04820 Trp_halogenase Tryptophan halogenase 2.9E-10 183 356
PF01494 FAD_binding_3 FAD binding domain 2.3E-07 7 38
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.6E-05 11 38
PF00890 FAD_binding_2 FAD binding domain 2.2E-04 9 39

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 1 440 2.0E-63

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4346
MAVPQNCTVLVIGGGPAGSYAAAVLAREGIDVVVLEADKFPRYHIGESTLPSLRHFFKFIDFYDAFNAYGFFHKN
GASFRLNQSQPDVCKFAPHLAHFHTDFIAAGGTEGYAWNLLRSESDDLLFRHAGTCGAHIFDVTRVDAIQFAPHD
CDSSLGSEHSKPESNPGRPVSATWSQRDSTSGVITFKYLIDASGRHGILSTKYLKNRNFNQNFKNIANWGYWKGD
KLYGTGTHMEGSPYFEALEDASGWCWFMPLHDGTRSVGIVQDQQMATNKKREQRSPSTLEFYKQSLELAPRTKSL
LEGAELVTDIKSASDWSYTASTYHLPYARICGDAGCFIDPLFSSGVHLAITGGLSAAVTIATSLRGNGDCDEQTA
GSWHSKKTVESYTRFFLAVCSATKQIRSQEEPIIQDMNEEGFQRAFDLLQPIIQGTVDADSTGKLTPSKVSKTLE
FCFKAFTFVPPEKKDALFDKLKKLGVDSGDADSARAVEDIKTYLTSEESQILDILRSRRMIREDPFEIESFTLDS
IDGLAPNLERGKLGLVKADKSKFNAPLLYSTPFLDGRFPTIRDDSDTGAPAACSLRGPDVGSIAC*
Coding >Hirsu2|4346
ATGGCCGTTCCTCAAAACTGTACCGTGCTGGTTATCGGCGGCGGCCCCGCGGGGTCTTACGCCGCTGCTGTCTTG
GCGCGCGAGGGCATCGATGTCGTGGTACTGGAGGCAGACAAGTTCCCCAGATACCACATCGGAGAAAGCACTCTT
CCCTCCCTACGCCATTTCTTCAAGTTCATAGACTTTTACGACGCCTTCAACGCTTACGGCTTCTTCCACAAGAAC
GGCGCGTCGTTCCGCCTCAACCAATCTCAGCCCGATGTCTGCAAGTTTGCCCCCCATCTTGCCCATTTCCATACC
GACTTCATCGCCGCCGGCGGGACTGAGGGATATGCCTGGAACCTGCTCCGCTCTGAGTCGGACGATCTGCTCTTC
AGACACGCTGGGACCTGCGGGGCTCATATCTTTGACGTTACCAGAGTCGATGCGATCCAGTTTGCACCACACGAC
TGCGACAGCAGCCTCGGCTCGGAGCATAGCAAGCCGGAATCGAATCCTGGCCGGCCCGTGTCTGCTACCTGGAGC
CAAAGAGATAGCACTTCAGGGGTTATCACGTTCAAGTACCTCATAGACGCCAGTGGGAGGCACGGCATACTCAGC
ACCAAGTATCTGAAGAATAGGAACTTCAACCAGAACTTCAAGAACATTGCAAACTGGGGCTACTGGAAAGGCGAC
AAGTTGTACGGCACAGGGACACACATGGAGGGCTCGCCGTACTTTGAGGCTTTGGAAGATGCCAGCGGATGGTGC
TGGTTCATGCCGTTGCACGATGGCACCCGCTCCGTGGGCATTGTCCAGGACCAACAGATGGCCACCAACAAGAAG
AGAGAGCAGCGATCTCCGTCCACGCTGGAGTTCTACAAGCAATCGCTCGAGCTGGCGCCCAGGACTAAGTCACTG
CTTGAGGGTGCAGAGCTCGTGACCGATATCAAATCGGCTTCAGACTGGTCCTACACCGCGTCTACCTACCACCTA
CCGTATGCCCGCATCTGCGGGGATGCCGGCTGTTTCATCGATCCCTTGTTCTCCTCCGGCGTCCATCTGGCCATC
ACGGGCGGCCTCTCAGCGGCAGTCACCATCGCTACGTCGCTTCGTGGCAACGGGGACTGCGATGAGCAGACGGCA
GGCTCGTGGCATTCCAAGAAGACGGTCGAGAGCTATACTCGATTCTTCCTCGCGGTCTGTAGCGCGACGAAGCAG
ATCCGCTCCCAGGAGGAGCCCATCATCCAAGACATGAATGAGGAGGGTTTCCAGAGAGCATTTGATCTTCTCCAG
CCAATCATCCAGGGCACGGTTGATGCCGACAGCACGGGCAAGCTGACGCCGTCGAAGGTCTCCAAGACGCTCGAG
TTCTGCTTCAAGGCCTTCACCTTCGTCCCGCCCGAGAAGAAGGACGCGCTGTTCGACAAGCTCAAGAAGCTCGGC
GTCGACTCCGGAGACGCCGACTCGGCCAGGGCGGTCGAGGACATCAAGACATACCTGACGTCCGAGGAGTCACAG
ATACTGGATATCCTGCGCAGCCGGCGCATGATCCGCGAGGACCCCTTCGAGATCGAGAGCTTCACCCTCGACTCG
ATCGACGGGCTCGCGCCGAACCTGGAGCGCGGCAAGCTTGGCCTCGTCAAGGCCGACAAGTCCAAGTTCAACGCG
CCCTTGCTGTATTCGACGCCCTTCCTGGACGGCAGGTTCCCGACCATCAGGGACGACAGCGATACCGGCGCCCCG
GCCGCGTGCAGTCTCCGCGGGCCGGATGTAGGGTCGATCGCGTGTTGA
Transcript >Hirsu2|4346
ATGGCCGTTCCTCAAAACTGTACCGTGCTGGTTATCGGCGGCGGCCCCGCGGGGTCTTACGCCGCTGCTGTCTTG
GCGCGCGAGGGCATCGATGTCGTGGTACTGGAGGCAGACAAGTTCCCCAGATACCACATCGGAGAAAGCACTCTT
CCCTCCCTACGCCATTTCTTCAAGTTCATAGACTTTTACGACGCCTTCAACGCTTACGGCTTCTTCCACAAGAAC
GGCGCGTCGTTCCGCCTCAACCAATCTCAGCCCGATGTCTGCAAGTTTGCCCCCCATCTTGCCCATTTCCATACC
GACTTCATCGCCGCCGGCGGGACTGAGGGATATGCCTGGAACCTGCTCCGCTCTGAGTCGGACGATCTGCTCTTC
AGACACGCTGGGACCTGCGGGGCTCATATCTTTGACGTTACCAGAGTCGATGCGATCCAGTTTGCACCACACGAC
TGCGACAGCAGCCTCGGCTCGGAGCATAGCAAGCCGGAATCGAATCCTGGCCGGCCCGTGTCTGCTACCTGGAGC
CAAAGAGATAGCACTTCAGGGGTTATCACGTTCAAGTACCTCATAGACGCCAGTGGGAGGCACGGCATACTCAGC
ACCAAGTATCTGAAGAATAGGAACTTCAACCAGAACTTCAAGAACATTGCAAACTGGGGCTACTGGAAAGGCGAC
AAGTTGTACGGCACAGGGACACACATGGAGGGCTCGCCGTACTTTGAGGCTTTGGAAGATGCCAGCGGATGGTGC
TGGTTCATGCCGTTGCACGATGGCACCCGCTCCGTGGGCATTGTCCAGGACCAACAGATGGCCACCAACAAGAAG
AGAGAGCAGCGATCTCCGTCCACGCTGGAGTTCTACAAGCAATCGCTCGAGCTGGCGCCCAGGACTAAGTCACTG
CTTGAGGGTGCAGAGCTCGTGACCGATATCAAATCGGCTTCAGACTGGTCCTACACCGCGTCTACCTACCACCTA
CCGTATGCCCGCATCTGCGGGGATGCCGGCTGTTTCATCGATCCCTTGTTCTCCTCCGGCGTCCATCTGGCCATC
ACGGGCGGCCTCTCAGCGGCAGTCACCATCGCTACGTCGCTTCGTGGCAACGGGGACTGCGATGAGCAGACGGCA
GGCTCGTGGCATTCCAAGAAGACGGTCGAGAGCTATACTCGATTCTTCCTCGCGGTCTGTAGCGCGACGAAGCAG
ATCCGCTCCCAGGAGGAGCCCATCATCCAAGACATGAATGAGGAGGGTTTCCAGAGAGCATTTGATCTTCTCCAG
CCAATCATCCAGGGCACGGTTGATGCCGACAGCACGGGCAAGCTGACGCCGTCGAAGGTCTCCAAGACGCTCGAG
TTCTGCTTCAAGGCCTTCACCTTCGTCCCGCCCGAGAAGAAGGACGCGCTGTTCGACAAGCTCAAGAAGCTCGGC
GTCGACTCCGGAGACGCCGACTCGGCCAGGGCGGTCGAGGACATCAAGACATACCTGACGTCCGAGGAGTCACAG
ATACTGGATATCCTGCGCAGCCGGCGCATGATCCGCGAGGACCCCTTCGAGATCGAGAGCTTCACCCTCGACTCG
ATCGACGGGCTCGCGCCGAACCTGGAGCGCGGCAAGCTTGGCCTCGTCAAGGCCGACAAGTCCAAGTTCAACGCG
CCCTTGCTGTATTCGACGCCCTTCCTGGACGGCAGGTTCCCGACCATCAGGGACGACAGCGATACCGGCGCCCCG
GCCGCGTGCAGTCTCCGCGGGCCGGATGTAGGGTCGATCGCGTGTTGA
Gene >Hirsu2|4346
ATGGCCGTTCCTCAAAACTGTACCGTGCTGGTTATCGGCGGCGGCCCCGCGGGGTCTTACGCCGCTGCTGTCTTG
GCGCGCGAGGGCATCGATGTCGTGGTACTGGAGGCAGACAAGTTCCCCAGGTTCGACCGCCATTGATGATGATAC
TTGTGTCGTCGGTCGCTCTTGAGCTTGGTCTCATTGGTCTGTGACAGATACCACATCGGAGAAAGCACTCTTCCC
TCCCTACGCCATTTCTTCAAGTTCATAGACTTTTACGACGCCTTCAACGCTTACGGCTTCTTCCACAAGGTAATC
CTCATGGCTCGTCTCGCACGCGTATTTCCAGAACGAACAGACGACTAAAATTCGCCCACAGAACGGCGCGTCGTT
CCGCCTCAACCAATCTCAGCCCGATGTCTGCAAGTTTGCCCCCCATCTTGCCCATTTCCGTCTGCCCTTCTTACA
TCTCTGTGCCGAAAAATAACTGACCTCTTCGAAGATACCGACTTCATCGCCGCCGGCGGGACTGAGGGATATGCC
TGGAACCTGCTCCGCTCTGAGTCGGACGATCTGCTCTTCAGACACGCTGGGACCTGCGGGGCTCATATCTTTGAC
GTTACCAGAGTCGATGCGATCCAGTTTGCACCACACGACTGCGACAGCAGCCTCGGCTCGGAGCATAGCAAGCCG
GAATCGAATCCTGGCCGGCCCGTGTCTGCTACCTGGAGCCAAAGAGATAGCACTTCAGGGGTTATCACGTTCAAG
TACCTCATAGACGCCAGTGGGAGGCACGGCATACTCAGCACCAAGTATCTGAAGAATAGGAACTTCAACCAGAAC
TTCAAGAACATTGCAAACTGGGGCTACTGGAAAGGCGACAAGTTGTACGGCACAGGGACACACATGGAGGGCTCG
CCGTACTTTGAGGCTTTGGAAGGTGGCCTTGCCCCGAGTCCTGCCCCGAGTTTCTGGCACATGCTGACGATGGAG
AGGCAGATGCCAGCGGATGGTGCTGGTTCATGCCGTTGCACGATGGCACCCGCTCCGTGGGCATTGTCCAGGACC
AACAGATGGCCACCAACAAGAAGAGAGAGCAGCGATCTCCGTCCACGCTGGAGTTCTACAAGCAATCGCTCGAGC
TGGCGCCCAGGACTAAGTCACTGCTTGAGGGTGCAGAGCTCGTGACCGATATCAAATCGGCTTCAGACTGGTCCT
ACACCGCGTCTACCTACCACCTACCGTATGCCCGCATCTGCGGGGATGCCGGCTGTTTCATCGATCCCTTGTTCT
CCTCCGGCGTCCATCTGGCCATCACGGGCGGCCTCTCAGCGGCAGTCACCATCGCTACGTCGCTTCGTGGCAACG
GGGACTGCGATGAGCAGACGGCAGGCTCGTGGCATTCCAAGAAGACGGTCGAGAGCTATACTCGATTCTTCCTCG
CGGTCTGTAGCGCGACGAAGCAGATCCGCTCCCAGGAGGAGCCCATCATCCAAGACATGAATGAGGAGGGTTTCC
AGAGAGCATTTGATCTTCTCCAGCCAAGTACGTCTTCTTTTACCATAATCAGCACAGGCTTCCGGCTGCGTCGCC
TGAGCGTCCAGAATCCAGAGCTGACGAGTCTGCTGTTCCAGTCATCCAGGGCACGGTTGATGCCGACAGCACGGG
CAAGCTGACGCCGTCGAAGGTCTCCAAGACGCTCGAGTTCTGCTTCAAGGCCTTCACCTTCGTCCCGCCCGAGAA
GAAGGACGCGCTGTTCGACAAGCTCAAGAAGCTCGGCGTCGACTCCGGAGACGCCGACTCGGCCAGGGCGGTCGA
GGACATCAAGACATACCTGACGTCCGAGGAGTCACAGATACTGGATATCCTGCGCAGCCGGCGCATGATCCGCGA
GGACCCCTTCGAGATCGAGAGCTTCACCCTCGACTCGATCGACGGGCTCGCGCCGAACCTGGAGCGCGGCAAGCT
TGGCCTCGTCAAGGCCGACAAGTCCAAGTTCAACGCGCCCTTGCTGTATTCGACGCCCTTCCTGGACGGCAGGTT
CCCGACCATCAGGGACGACAGCGATACCGGCGCCCCGGCCGCGTGCAGTCTCCGCGGGCCGGATGTAGGGTCGAT
CGCGTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail