Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4345
Gene name
LocationContig_222:6110..9660
Strand-
Gene length (bp)3550
Transcript length (bp)3075
Coding sequence length (bp)3075
Protein length (aa) 1025

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 2.8E-06 723 812

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04336|YM54_YEAST Uncharacterized protein YMR196W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR196W PE=1 SV=1 11 954 0.0E+00
sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH41 PE=1 SV=1 719 900 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4345
MVVFDGHEYLTEEEKRLKEDRERTKYWKKWGPYVAERQWATVREDYSSDGDAWSHFPHNHARSRAFRWGEDGIAG
VSDTHGLQNIAFSFWNEQDDFLKERLFGLSNPQGNHGESVKEAHFHLDNTPHSYMKFLYKYPQTKFPYDDLLKEN
ARRSKEDKEYQIIDTGAFDDDRYWDIFIETAKESDDPDELLFRVTAWNRGPDPAPLHIAPHLWFRNTWSWGRDPE
DRKPSIEACTEISAKSKHHSLGERYLLLSPSPGVGSSGEDVLPKLIFTENDTNFKALYDQDNKQPYVKDAFHRHI
VGGEKGAINPAQTGTKCAAWFVFNEDGGVDPGECAVVRFRFTKKNLTFLDEEEFDDVIERRREEADEFYYRVSPL
PMTDDLRNIQRQAFAGMMWTKQYYHFVWDHWANGDPSMPPPPANRIGIRNSQWKHMHCDDILSMPDSWEYPFFAA
WDSAFHCIPLAMIDPDFAKKQLDLFTREWYCHPNGQLPAYEWNFSDVNPPVHAWATFRVFKIERKMYGRQDLDFL
ERVFQKLLLNFTWWVNRKDTDGKNVFEGGFLGLDNIGLFNRSEPLPTGGVLEQADSTGWMAFFCLSMLNIALELA
KHRRIYEDIASKFFEHFIFISDAMTFRAGHKDEQALWNEEDGFYYDAISWGGPWIQQLPVRSLVGLIPLYATTTL
EPELINRLPSFRKRVEWFVNNRCDIAERNMASIRKRGKGNRILLSIVSKDRLEKILKRMLDEDEFLSDHGIRSLS
KYHKEHPYSMDVNGQRFTVGYVPGDSDSGLFGGNSNWRGPIWLCVNFLLVESIQRFYLFYGPEFQVECPTGSGDY
MHLGKVAEEIQHRLQHLFIRTDDGRRSVNAGDDRLDFNEHWRDNLWFHEFFDGDSGRGLGASHQCGWTGLIARMI
HDTGVNCRLPQTPRTPSVAMAHYFDDMFQRSIDMGAPRSPGSRRIRRSSTARSISARSDFDASTNGFDEEAPSAT
NSVFPEDATQAREKAEADSHMHQYISDQLNRYRNQNGDYRHADEFETQA*
Coding >Hirsu2|4345
ATGGTTGTCTTCGACGGCCACGAGTATCTCACCGAGGAAGAGAAGCGTCTCAAAGAGGATCGAGAGCGCACCAAA
TACTGGAAGAAGTGGGGACCCTACGTCGCCGAGCGGCAGTGGGCCACCGTCAGAGAGGACTACAGCTCCGATGGA
GATGCTTGGAGTCACTTCCCGCACAACCATGCCCGCTCGCGCGCCTTCCGATGGGGGGAAGATGGCATCGCCGGT
GTCTCGGATACGCATGGCCTGCAGAACATTGCCTTCAGCTTCTGGAATGAGCAAGACGATTTCCTGAAAGAGAGG
CTCTTCGGTCTCTCCAACCCGCAGGGCAACCATGGCGAGAGCGTCAAGGAGGCCCATTTCCATCTCGACAATACC
CCTCATTCCTACATGAAGTTTTTGTACAAATATCCTCAGACCAAGTTCCCTTACGACGACCTGCTGAAAGAGAAT
GCGAGGAGGTCCAAGGAGGACAAGGAGTATCAAATCATCGACACCGGAGCTTTTGACGATGATCGCTACTGGGAC
ATCTTCATCGAGACCGCCAAGGAATCCGATGACCCCGACGAGCTTCTGTTCCGAGTCACTGCTTGGAACAGGGGT
CCCGACCCTGCCCCCCTTCACATTGCGCCACACCTATGGTTCCGAAACACCTGGAGCTGGGGCCGAGATCCAGAA
GACCGGAAGCCTTCCATCGAGGCTTGTACAGAGATATCTGCCAAGTCAAAGCATCACAGCCTGGGCGAGCGGTAC
TTGCTCCTCTCCCCATCCCCCGGCGTAGGATCGAGTGGAGAGGACGTCCTTCCCAAGCTCATATTTACCGAGAAC
GACACCAACTTCAAGGCCTTGTATGATCAGGACAACAAGCAACCATATGTCAAGGATGCCTTCCATCGCCACATC
GTCGGGGGCGAAAAGGGCGCCATCAACCCGGCCCAAACCGGCACGAAATGCGCAGCCTGGTTCGTCTTCAACGAG
GACGGGGGGGTCGACCCCGGGGAGTGTGCCGTCGTTCGCTTTCGCTTCACAAAAAAGAACCTGACGTTCCTCGAT
GAAGAAGAATTTGACGACGTGATCGAGAGGCGCAGGGAGGAGGCGGACGAGTTCTACTATCGTGTTAGTCCACTG
CCCATGACGGATGACCTCCGCAACATCCAGAGGCAGGCCTTCGCCGGAATGATGTGGACGAAGCAGTACTACCAC
TTCGTGTGGGATCATTGGGCGAACGGCGACCCCTCGATGCCTCCTCCGCCGGCAAACCGAATCGGGATCCGGAAT
TCGCAGTGGAAGCACATGCACTGCGACGATATTTTGTCTATGCCCGACTCGTGGGAATACCCCTTCTTCGCCGCC
TGGGACAGCGCTTTTCACTGCATCCCGTTGGCCATGATCGACCCGGATTTTGCCAAGAAGCAGCTGGACTTGTTT
ACCCGAGAGTGGTACTGTCATCCCAACGGGCAGCTCCCGGCGTACGAGTGGAATTTTAGTGATGTCAACCCTCCT
GTCCATGCCTGGGCCACTTTTAGGGTCTTCAAAATCGAGAGAAAGATGTACGGCCGACAAGACCTCGACTTTCTG
GAGCGAGTCTTCCAGAAACTGCTCCTAAACTTTACCTGGTGGGTGAACCGCAAGGATACGGATGGCAAGAATGTT
TTCGAAGGAGGCTTCCTAGGCTTGGACAACATCGGCCTGTTCAATCGATCCGAGCCCTTGCCGACGGGAGGCGTC
CTGGAACAGGCCGACAGCACCGGGTGGATGGCCTTTTTCTGCCTCTCCATGCTCAACATCGCTCTCGAGCTGGCA
AAGCATCGCCGTATCTACGAAGACATCGCTTCAAAGTTCTTCGAGCATTTCATCTTCATCAGCGACGCCATGACT
TTCAGAGCCGGACACAAAGATGAACAGGCCCTCTGGAACGAAGAGGACGGTTTCTACTACGACGCCATATCTTGG
GGGGGGCCCTGGATTCAGCAGCTTCCCGTCAGATCGCTGGTGGGCTTGATTCCTCTTTACGCCACGACGACGCTT
GAGCCCGAGCTCATCAACAGACTGCCCTCCTTTAGGAAAAGGGTCGAGTGGTTCGTGAACAACCGGTGCGACATT
GCTGAGAGAAACATGGCCAGCATCCGCAAGCGGGGTAAAGGAAACCGTATCCTGCTCTCCATTGTCAGCAAAGAC
AGGCTGGAGAAGATCCTTAAGCGGATGCTCGACGAGGACGAATTCCTCAGCGACCACGGCATCCGCTCGCTGTCC
AAGTACCACAAGGAGCACCCTTATTCCATGGATGTGAACGGACAGAGATTCACTGTAGGTTATGTCCCCGGAGAC
TCGGACAGCGGCTTGTTTGGTGGCAACAGCAACTGGAGGGGCCCCATCTGGCTCTGTGTCAACTTTCTCCTGGTC
GAGTCGATACAGCGTTTCTACCTCTTTTACGGACCCGAATTCCAGGTCGAGTGTCCCACGGGAAGCGGTGATTAC
ATGCATCTGGGCAAGGTGGCCGAAGAAATCCAGCACCGCCTCCAGCACCTCTTCATTCGCACCGATGATGGCAGA
CGAAGCGTCAACGCCGGCGACGATCGTTTGGACTTCAACGAGCACTGGAGGGATAACCTCTGGTTCCACGAGTTC
TTCGACGGCGACTCGGGGCGAGGCCTCGGCGCAAGTCATCAGTGCGGCTGGACAGGCTTGATCGCCCGAATGATC
CACGACACGGGCGTCAACTGCCGTCTGCCGCAAACCCCCCGCACCCCGTCGGTCGCGATGGCTCACTACTTCGAT
GACATGTTCCAGCGAAGCATTGACATGGGTGCGCCTCGCTCGCCTGGGTCGCGGCGGATCAGGCGGTCCTCGACC
GCGCGCTCCATCAGTGCCCGCAGCGACTTTGACGCGTCGACCAACGGCTTCGACGAGGAGGCTCCCTCGGCCACG
AACTCCGTCTTCCCCGAGGACGCGACGCAGGCGCGAGAAAAGGCCGAGGCCGACTCGCACATGCACCAGTACATC
TCTGACCAGCTCAACCGGTACAGGAACCAGAACGGCGACTACAGGCATGCGGATGAGTTCGAGACGCAGGCCTAA
Transcript >Hirsu2|4345
ATGGTTGTCTTCGACGGCCACGAGTATCTCACCGAGGAAGAGAAGCGTCTCAAAGAGGATCGAGAGCGCACCAAA
TACTGGAAGAAGTGGGGACCCTACGTCGCCGAGCGGCAGTGGGCCACCGTCAGAGAGGACTACAGCTCCGATGGA
GATGCTTGGAGTCACTTCCCGCACAACCATGCCCGCTCGCGCGCCTTCCGATGGGGGGAAGATGGCATCGCCGGT
GTCTCGGATACGCATGGCCTGCAGAACATTGCCTTCAGCTTCTGGAATGAGCAAGACGATTTCCTGAAAGAGAGG
CTCTTCGGTCTCTCCAACCCGCAGGGCAACCATGGCGAGAGCGTCAAGGAGGCCCATTTCCATCTCGACAATACC
CCTCATTCCTACATGAAGTTTTTGTACAAATATCCTCAGACCAAGTTCCCTTACGACGACCTGCTGAAAGAGAAT
GCGAGGAGGTCCAAGGAGGACAAGGAGTATCAAATCATCGACACCGGAGCTTTTGACGATGATCGCTACTGGGAC
ATCTTCATCGAGACCGCCAAGGAATCCGATGACCCCGACGAGCTTCTGTTCCGAGTCACTGCTTGGAACAGGGGT
CCCGACCCTGCCCCCCTTCACATTGCGCCACACCTATGGTTCCGAAACACCTGGAGCTGGGGCCGAGATCCAGAA
GACCGGAAGCCTTCCATCGAGGCTTGTACAGAGATATCTGCCAAGTCAAAGCATCACAGCCTGGGCGAGCGGTAC
TTGCTCCTCTCCCCATCCCCCGGCGTAGGATCGAGTGGAGAGGACGTCCTTCCCAAGCTCATATTTACCGAGAAC
GACACCAACTTCAAGGCCTTGTATGATCAGGACAACAAGCAACCATATGTCAAGGATGCCTTCCATCGCCACATC
GTCGGGGGCGAAAAGGGCGCCATCAACCCGGCCCAAACCGGCACGAAATGCGCAGCCTGGTTCGTCTTCAACGAG
GACGGGGGGGTCGACCCCGGGGAGTGTGCCGTCGTTCGCTTTCGCTTCACAAAAAAGAACCTGACGTTCCTCGAT
GAAGAAGAATTTGACGACGTGATCGAGAGGCGCAGGGAGGAGGCGGACGAGTTCTACTATCGTGTTAGTCCACTG
CCCATGACGGATGACCTCCGCAACATCCAGAGGCAGGCCTTCGCCGGAATGATGTGGACGAAGCAGTACTACCAC
TTCGTGTGGGATCATTGGGCGAACGGCGACCCCTCGATGCCTCCTCCGCCGGCAAACCGAATCGGGATCCGGAAT
TCGCAGTGGAAGCACATGCACTGCGACGATATTTTGTCTATGCCCGACTCGTGGGAATACCCCTTCTTCGCCGCC
TGGGACAGCGCTTTTCACTGCATCCCGTTGGCCATGATCGACCCGGATTTTGCCAAGAAGCAGCTGGACTTGTTT
ACCCGAGAGTGGTACTGTCATCCCAACGGGCAGCTCCCGGCGTACGAGTGGAATTTTAGTGATGTCAACCCTCCT
GTCCATGCCTGGGCCACTTTTAGGGTCTTCAAAATCGAGAGAAAGATGTACGGCCGACAAGACCTCGACTTTCTG
GAGCGAGTCTTCCAGAAACTGCTCCTAAACTTTACCTGGTGGGTGAACCGCAAGGATACGGATGGCAAGAATGTT
TTCGAAGGAGGCTTCCTAGGCTTGGACAACATCGGCCTGTTCAATCGATCCGAGCCCTTGCCGACGGGAGGCGTC
CTGGAACAGGCCGACAGCACCGGGTGGATGGCCTTTTTCTGCCTCTCCATGCTCAACATCGCTCTCGAGCTGGCA
AAGCATCGCCGTATCTACGAAGACATCGCTTCAAAGTTCTTCGAGCATTTCATCTTCATCAGCGACGCCATGACT
TTCAGAGCCGGACACAAAGATGAACAGGCCCTCTGGAACGAAGAGGACGGTTTCTACTACGACGCCATATCTTGG
GGGGGGCCCTGGATTCAGCAGCTTCCCGTCAGATCGCTGGTGGGCTTGATTCCTCTTTACGCCACGACGACGCTT
GAGCCCGAGCTCATCAACAGACTGCCCTCCTTTAGGAAAAGGGTCGAGTGGTTCGTGAACAACCGGTGCGACATT
GCTGAGAGAAACATGGCCAGCATCCGCAAGCGGGGTAAAGGAAACCGTATCCTGCTCTCCATTGTCAGCAAAGAC
AGGCTGGAGAAGATCCTTAAGCGGATGCTCGACGAGGACGAATTCCTCAGCGACCACGGCATCCGCTCGCTGTCC
AAGTACCACAAGGAGCACCCTTATTCCATGGATGTGAACGGACAGAGATTCACTGTAGGTTATGTCCCCGGAGAC
TCGGACAGCGGCTTGTTTGGTGGCAACAGCAACTGGAGGGGCCCCATCTGGCTCTGTGTCAACTTTCTCCTGGTC
GAGTCGATACAGCGTTTCTACCTCTTTTACGGACCCGAATTCCAGGTCGAGTGTCCCACGGGAAGCGGTGATTAC
ATGCATCTGGGCAAGGTGGCCGAAGAAATCCAGCACCGCCTCCAGCACCTCTTCATTCGCACCGATGATGGCAGA
CGAAGCGTCAACGCCGGCGACGATCGTTTGGACTTCAACGAGCACTGGAGGGATAACCTCTGGTTCCACGAGTTC
TTCGACGGCGACTCGGGGCGAGGCCTCGGCGCAAGTCATCAGTGCGGCTGGACAGGCTTGATCGCCCGAATGATC
CACGACACGGGCGTCAACTGCCGTCTGCCGCAAACCCCCCGCACCCCGTCGGTCGCGATGGCTCACTACTTCGAT
GACATGTTCCAGCGAAGCATTGACATGGGTGCGCCTCGCTCGCCTGGGTCGCGGCGGATCAGGCGGTCCTCGACC
GCGCGCTCCATCAGTGCCCGCAGCGACTTTGACGCGTCGACCAACGGCTTCGACGAGGAGGCTCCCTCGGCCACG
AACTCCGTCTTCCCCGAGGACGCGACGCAGGCGCGAGAAAAGGCCGAGGCCGACTCGCACATGCACCAGTACATC
TCTGACCAGCTCAACCGGTACAGGAACCAGAACGGCGACTACAGGCATGCGGATGAGTTCGAGACGCAGGCCTAA
Gene >Hirsu2|4345
ATGGTTGTCTTCGACGGCCACGAGTATCTCACCGAGGAAGAGAAGCGTCTCAAAGAGGATCGAGAGCGCACCAAA
TACTGGAAGAAGTGGGGACCCTACGTCGCCGAGCGGCAGTGGGCCACCGGTATGCGAGACCCGAGTCTCGAGTCT
CGACCATCTCGAGGCGGTCGGCTAACTGAGCTGCAGTCAGAGAGGACTACAGCTCCGATGGAGATGCTTGGAGTC
GTATGGACAGCCCCGTTCCCCTCGAGGACGCTCATTGACCACCTTCCCAGACTTCCCGCACAACCATGCCCGCTC
GCGCGCCTTCCGATGGGGGGAAGATGGCATCGCCGGTGTCTCGGATACGCATGGCCTGCAGAACATTGCCTTCAG
CTTCTGGAATGAGCAAGAGTATGTCCTTCCGGTCCGCCTCCCCACCCCGGCTCTCGCCTGATTCGCTGCAGCGAT
TTCCTGAAAGAGAGGCTCTTCGGTCTCTCCAACCCGCAGGGCAACCATGGCGAGAGCGTCAAGGAGGCCCATTTC
CATCTCGACAATACCCCTGTAAGTCGACTACCGGTCCATTGGCTCACCCACTACCTGCCCTGACATGCACGAGCA
TCTTTACTGACGATTTTGGGCAGACGGTATGACCAGCGAACACAACTTCCGTCGGGCCGCCCACACCACTAACTC
GTCGCAGCATTCCTACATGAAGTTTTTGTACAAATATCCTCAGACCAAGTTCCCTTACGACGACCTGCTGAAAGA
GAATGCGAGGAGGTCCAAGGAGGACAAGGAGTATCAAATCATCGACACCGGAGCTTTTGACGATGATCGCTACTG
GGACATCTTCATCGAGACCGCCAAGGAATCCGATGACCCCGACGAGCTTCTGTTCCGAGTCACTGCTTGGAACAG
GGGTCCCGACCCTGCCCCCCTTCACATTGCGCCACACCTATGGTTCCGAAACACCTGGAGCTGGGGCCGAGATCC
AGAAGACCGGAAGCCTTCCATCGAGGCTTGTACAGAGATATCTGCCAAGTCAAAGCATCACAGCCTGGGCGAGCG
GTACTTGCTCCTCTCCCCATCCCCCGGCGTAGGATCGAGTGGAGAGGACGTCCTTCCCAAGCTCATATTTACCGA
GAACGACACCAACTTCAAGGCCTTGTATGATCAGGACAACAAGCAACCATATGTCAAGGATGCCTTCCATCGCCA
CATCGTCGGGGGCGAAAAGGGCGCCATCAACCCGGCCCAAACCGGCACGAAATGCGCAGCCTGGTTCGTCTTCAA
CGAGGACGGGGGGGTCGACCCCGGGGAGTGTGCCGGTACGGTCAATACCTGCATTACCCCATCCGCACAGAAGTG
TGTCTGGCTGACTGTATCCCAGTCGTTCGCTTTCGCTTCACAAAAAAGAACCTGACGTTCCTCGATGAAGAAGAA
TTTGACGACGTGATCGAGAGGCGCAGGGAGGAGGCGGACGAGTTCTACTATCGTGTTAGTCCACTGCCCATGACG
GATGACCTCCGCAACATCCAGAGGCAGGCCTTCGCCGGAATGATGTGGACGAAGCAGTACTACCACTTCGTGTGG
GATCATTGGGCGAACGGCGACCCCTCGATGCCTCCTCCGCCGGCAAACCGAATCGGGATCCGGAATTCGCAGTGG
AAGCACATGCACTGCGACGATATTTTGTCTATGCCCGACTCGTGGGAATACCCCTTCTTCGCCGCCTGGGACAGC
GCTTTTCACTGCATCCCGTTGGCCATGATCGACCCGGATTTTGCCAAGAAGCAGCTGGACTTGTTTACCCGAGAG
TGGTACTGTCATCCCAACGGGCAGCTCCCGGCGTGAGTTTCAGCGTACCCCTTTCCCTCGCGCGTTGTCTGACAG
GCCCTCAAAACAGGTACGAGTGGAATTTTAGTGATGTCAACCCTCCTGTCCATGCCTGGGCCACTTTTAGGGTCT
TCAAAATCGAGAGAAAGATGTACGGCCGACAAGACCTCGACTTTCTGGAGCGAGTCTTCCAGAAACTGCTCCTAA
ACTTTACCTGGTGGGTGAACCGCAAGGATACGGATGGCAAGAATGTTTTCGAAGGAGGCTTCCTAGGCTTGGACA
ACATCGGCCTGTTCAATCGATCCGAGCCCTTGCCGACGGGAGGCGTCCTGGAACAGGCCGACAGCACCGGGTGGA
TGGCCTTTTTCTGCCTCTCCATGCTCAACATCGCTCTCGAGCTGGCAAAGCATCGCCGTATCTACGAAGACATCG
CTTCAAAGTTCTTCGAGCATTTCATCTTCATCAGCGACGCCATGACTTTCAGAGCCGGACACAAAGATGAACAGG
CCCTCTGGAACGAAGAGGACGGTTTCTACTACGACGCCATATCTTGGGGGGGGCCCTGGATTCAGCAGCTTCCCG
TCAGATCGCTGGTGGGCTTGATTCCTCTTTACGCCACGACGACGCTTGAGCCCGAGCTCATCAACAGACTGCCCT
CCTTTAGGAAAAGGGTCGAGTGGTTCGTGAACAACCGGTGCGACATTGCTGAGAGAAACATGGCCAGCATCCGCA
AGCGGGGTAAAGGAAACCGTATCCTGCTCTCCATTGTCAGCAAAGACAGGCTGGAGAAGATCCTTAAGCGGATGC
TCGACGAGGACGAATTCCTCAGCGACCACGGCATCCGCTCGCTGTCCAAGTACCACAAGGAGCACCCTTATTCCA
TGGATGTGAACGGACAGAGATTCACTGTAGGTTATGTCCCCGGAGACTCGGACAGCGGCTTGTTTGGTGGCAACA
GCAACTGGAGGGGCCCCATCTGGCTCTGTGTCAACTTTCTCCTGGTCGAGTCGATACAGCGTTTCTACCTCTTTT
ACGGACCCGAATTCCAGGTCGAGTGTCCCACGGGAAGCGGTGATTACATGCATCTGGGCAAGGTGGCCGAAGAAA
TCCAGCACCGCCTCCAGCACCTCTTCATTCGCACCGATGATGGCAGACGAAGCGTCAACGCCGGCGACGATCGTT
TGGACTTCAACGAGCACTGGAGGGATAACCTCTGGTTCCACGAGTTCTTCGACGGCGACTCGGGGCGAGGCCTCG
GCGCAAGTCATCAGTGCGGCTGGACAGGCTTGATCGCCCGAATGATCCACGACACGGGGTAGGTTGCAGCGCGCC
GACGAGAAGAAGATGCCCGGCTAATGGTAGAAATAGCGTCAACTGCCGTCTGCCGCAAACCCCCCGCACCCCGTC
GGTCGCGATGGCTCACTACTTCGATGACATGTTCCAGCGAAGCATTGACATGGGTGCGCCTCGCTCGCCTGGGTC
GCGGCGGATCAGGCGGTCCTCGACCGCGCGCTCCATCAGTGCCCGCAGCGACTTTGACGCGTCGACCAACGGCTT
CGACGAGGAGGCTCCCTCGGCCACGAACTCCGTCTTCCCCGAGGACGCGACGCAGGCGCGAGAAAAGGCCGAGGC
CGACTCGCACATGCACCAGTACATCTCTGACCAGCTCAACCGGTACAGGAACCAGAACGGCGACTACAGGCATGC
GGATGAGTTCGAGACGCAGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail