Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4333
Gene name
LocationContig_2210:94..3355
Strand+
Gene length (bp)3261
Transcript length (bp)3063
Coding sequence length (bp)3063
Protein length (aa) 1021

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 6.8E-64 796 1010
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.1E-06 616 664
PF13246 Cation_ATPase Cation transport ATPase (P-type) 9.4E-11 302 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 2 1019 0.0E+00
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 540 1019 4.0E-141
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 1 447 5.0E-94
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 555 961 6.0E-94
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 555 1001 8.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 2 1019 0.0E+00
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 540 1019 4.0E-141
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 1 447 5.0E-94
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 555 961 6.0E-94
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 555 1001 8.0E-94
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 555 961 8.0E-94
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 555 961 6.0E-93
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 548 926 2.0E-92
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 548 926 2.0E-92
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 544 1001 3.0E-92
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 544 988 5.0E-92
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 548 926 6.0E-92
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 544 994 2.0E-90
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 559 988 4.0E-89
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 548 925 2.0E-88
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 545 992 8.0E-88
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 556 996 2.0E-86
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 559 1003 1.0E-84
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 559 1005 5.0E-84
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 555 948 1.0E-83
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 545 988 5.0E-83
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 555 925 7.0E-83
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 560 988 1.0E-82
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 560 1006 2.0E-82
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 544 1004 2.0E-82
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 546 1003 3.0E-82
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 544 1005 5.0E-82
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 544 1004 1.0E-81
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 560 988 5.0E-81
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 480 930 9.0E-81
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 542 931 5.0E-80
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 559 1010 1.0E-77
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 559 1010 2.0E-77
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 549 943 7.0E-77
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 541 977 7.0E-77
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 561 930 7.0E-77
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 564 995 1.0E-75
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 560 1003 2.0E-74
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 550 1018 5.0E-74
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 550 1013 7.0E-73
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 561 932 2.0E-72
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 560 1003 2.0E-70
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 559 929 1.0E-67
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 550 962 3.0E-65
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 560 962 3.0E-64
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 561 930 1.0E-57
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 1 409 1.0E-55
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 563 982 2.0E-54
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 559 928 5.0E-54
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 1 414 2.0E-53
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 729 930 4.0E-53
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 559 928 5.0E-53
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 559 928 8.0E-53
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 559 928 2.0E-52
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 559 928 3.0E-52
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 563 928 2.0E-51
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 559 928 3.0E-51
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 8 416 2.0E-50
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 1 396 1.0E-49
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 1 396 2.0E-49
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 1 498 5.0E-49
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 1 403 9.0E-49
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 1 403 2.0E-48
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 1 396 3.0E-48
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 563 956 3.0E-48
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 8 399 1.0E-47
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 2 396 1.0E-46
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 2 397 2.0E-46
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 8 396 3.0E-46
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 8 425 4.0E-46
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 729 926 2.0E-45
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 2 405 3.0E-45
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 729 926 4.0E-45
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 2 464 6.0E-45
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 2 396 1.0E-44
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 2 396 6.0E-44
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 1 396 4.0E-43
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 2 399 4.0E-43
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 2 396 9.0E-43
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 1 396 8.0E-42
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 2 396 1.0E-41
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 1 396 1.0E-41
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 3 396 2.0E-41
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 2 395 3.0E-35
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 1 390 1.0E-31
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 7 188 9.0E-28
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 7 188 3.0E-27
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 3 207 3.0E-27
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 3 189 4.0E-27
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 7 189 5.0E-27
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 1 237 2.0E-25
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 2 423 5.0E-25
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 5 261 1.0E-24
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 8 188 2.0E-24
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 7 188 5.0E-24
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 1 199 1.0E-23
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 2 185 2.0E-22
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 2 189 2.0E-22
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 2 189 8.0E-22
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 1 185 2.0E-21
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 564 666 2.0E-21
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 2 183 3.0E-21
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 550 673 3.0E-21
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 286 396 7.0E-21
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 286 396 7.0E-21
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 287 396 2.0E-20
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 7 183 2.0E-20
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 3 441 2.0E-20
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 287 396 7.0E-20
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 286 403 9.0E-20
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 7 183 2.0E-19
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 3 423 5.0E-19
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 3 423 2.0E-18
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 3 423 4.0E-18
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 564 666 7.0E-18
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 3 423 1.0E-17
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 3 423 1.0E-17
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 268 396 1.0E-17
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 3 423 2.0E-17
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 286 412 5.0E-17
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 3 183 3.0E-16
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 278 410 1.0E-13
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 281 397 2.0E-13
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 281 413 2.0E-12
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 269 495 7.0E-12
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 269 408 3.0E-11
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 287 397 6.0E-11
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 287 395 8.0E-10
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 2 181 9.0E-10
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 531 796 3.0E-09
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 612 796 2.0E-08
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 306 416 2.0E-07
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 588 794 5.0E-07
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 610 792 1.0E-06
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 301 399 2.0E-06
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 703 841 2.0E-06
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 703 841 2.0E-06
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 615 791 3.0E-06
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 307 399 3.0E-06
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 709 841 4.0E-06
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 307 396 4.0E-06
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 614 791 5.0E-06
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 614 791 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 99 121 22
3 908 930 22
4 943 965 22
5 975 997 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4333
LPLTLANVLYRGSVLRNTAEAVGLVVNAGEECKIRLNASKNVRAKKPAMQAAINRMVLFQIAIVAGLAAGLTVGY
HLWRRRVEARSPYLDGARVPIRQVFFGYLVMFNTLIPLSLYISMEIIKIGQLLLMHDVHMYDPASDTPMVANTTT
ILENLGQVTHLFSDKTGTMTENVMRFRKLSVAGAACLHHRRHLNDDDDDGHDDDRHDRSKNNKGKSTTTTTTTTT
TTVVEEGVEEKESFHGLGGVHHFSSSSSSSSASRRGEMNTRELLDYIRHKPNTTFSRKAMHFLLCIALCHTCLPE
TGPDGRIAYQAASPDELALVEAARDMGLVVVDRPAQAIRLRRQTRDGQPAPTETYQVLDVIEFSSRRKRMSVVVR
MPDGRLCLICKGADNVITSRLRLSHLAQEKARAIGRRASVRKTFEQEQAMRRMSGGSLHATTPRTSLAERRKRAS
GGASLDLARLAAAGRAGQKTTMMMQESAVTPTTMTMTTMTTMTTTTTTPPPFSPTRGSPADPVVSRSPRWSLDDF
GIADSGAGGPGPGVGRVDESLAANDASVFERCFQHVDDFATDGLRTLLYAYRYLDEESYARWKRLYREAETSLVD
RERLVEEAGEQLETGLELAGATAIEDKLQEGVAETIDKLRRAGIKVWMLTGDKRETAINIGHSARLCKPYSEVYV
LDAAGPGGLEGLREALTATLTDVCRGMVPHSVVVVDGQTLAAVEADAAGLAALFGDLAVRVDSVICCRASPAQKA
ALVKSIRRRLAGSMTLAVGDGANDIGMIQASHVGVGISGREGLQAARIADYAVAQFRFLQRLLLVHGRWNYIRTG
KYVLATFWKEVLFFLVQAHYQRLDGYSGTSLFESASLTVFNTAFTSLPVILLGIFERDLAPETLLAFPELYALGQ
RRLGFNFAQYLGWMLMAVAGSFVIFYTAYGTEARALFTSDTSLFAMGNICFTVAVVFINVKLLVLELHCKTVITF
TGFVLSVGGWFLWNVVLSFVYAESAGPYPVRDAFFHNFGRQASWT*
Coding >Hirsu2|4333
CTGCCCCTGACGCTCGCCAACGTCCTCTACCGCGGCTCCGTCCTGCGCAACACGGCCGAGGCCGTCGGCCTCGTC
GTCAACGCCGGCGAGGAGTGCAAGATCCGCCTCAACGCCAGCAAGAACGTCCGCGCCAAGAAGCCGGCCATGCAG
GCCGCCATCAACCGCATGGTCCTCTTCCAGATCGCCATCGTCGCCGGCCTCGCCGCCGGCCTGACCGTCGGCTAC
CACCTGTGGCGCCGCCGCGTCGAGGCCCGCTCGCCCTACCTCGACGGCGCCCGCGTGCCCATCCGCCAGGTCTTC
TTCGGCTACCTCGTCATGTTCAACACCCTCATCCCCCTCTCGCTCTACATCAGCATGGAGATCATCAAGATCGGC
CAGCTGCTCCTCATGCACGACGTCCACATGTACGACCCGGCCTCCGACACCCCCATGGTCGCCAACACCACCACC
ATCCTCGAGAACCTCGGCCAGGTCACCCACCTCTTCTCCGACAAGACCGGCACCATGACGGAGAACGTGATGCGC
TTCCGCAAGCTCAGCGTCGCCGGCGCCGCCTGCCTGCATCACCGCCGGCACCTCAACGATGACGACGACGACGGC
CACGACGACGACCGCCATGACCGTTCCAAGAACAACAAGGGCAAGTCGACGACGACGACGACGACGACGACGACG
ACGACGGTCGTGGAGGAGGGCGTGGAGGAGAAGGAGTCGTTTCACGGCCTCGGCGGCGTACACCACTTTTCCTCT
TCTTCTTCCTCTTCATCCGCGTCCCGTCGCGGCGAGATGAACACGCGGGAGCTGCTCGACTACATCCGCCACAAG
CCCAACACAACCTTCTCGCGCAAGGCCATGCACTTCCTCCTCTGCATCGCCCTGTGCCACACCTGCCTGCCCGAG
ACGGGCCCCGACGGCCGCATCGCCTACCAGGCCGCGTCTCCCGACGAGCTGGCCCTGGTCGAGGCCGCGCGCGAC
ATGGGCCTCGTCGTCGTCGACCGCCCCGCCCAGGCCATCCGGCTGCGGCGGCAGACGCGCGACGGCCAACCGGCC
CCGACCGAGACGTACCAGGTCCTCGACGTCATCGAGTTCAGCAGCCGCCGCAAGCGCATGTCCGTCGTCGTCCGC
ATGCCCGACGGCCGCCTCTGCCTCATCTGCAAGGGAGCCGACAACGTCATCACCTCGCGCCTGCGCCTGAGCCAC
CTGGCCCAGGAGAAGGCCCGCGCCATCGGCCGCCGCGCCAGCGTGCGCAAGACGTTCGAGCAGGAGCAGGCCATG
CGCCGCATGAGCGGCGGCAGCCTCCACGCCACGACGCCCCGGACCAGCCTCGCCGAGCGCCGCAAGCGGGCCAGC
GGCGGCGCCTCGCTCGACCTCGCCCGGCTGGCTGCCGCCGGGAGGGCGGGGCAAAAGACGACGATGATGATGCAG
GAAAGCGCGGTGACGCCGACAACGATGACGATGACGACGATGACGACGATGACGACGACGACGACGACGCCGCCG
CCCTTCTCGCCGACCCGAGGCTCGCCCGCCGACCCGGTGGTGTCGCGGAGCCCGAGGTGGAGCCTGGACGACTTC
GGCATCGCCGACTCCGGCGCCGGCGGCCCCGGACCAGGGGTCGGGCGGGTGGACGAGTCGCTGGCGGCCAACGAC
GCGTCCGTGTTCGAGCGGTGCTTCCAGCACGTCGACGACTTCGCGACGGACGGGCTGCGGACGCTGCTGTACGCG
TACCGCTACCTCGACGAGGAGTCGTACGCGCGGTGGAAGCGGCTGTACCGCGAGGCCGAGACGAGCCTGGTGGAC
CGCGAGCGGCTGGTGGAGGAGGCGGGCGAGCAGCTGGAGACGGGCCTCGAGCTGGCCGGGGCGACGGCCATCGAG
GACAAGCTGCAGGAGGGCGTGGCGGAGACGATCGACAAGCTGCGGCGGGCCGGGATCAAGGTGTGGATGCTGACG
GGCGACAAGCGCGAGACGGCCATCAACATCGGGCACTCGGCGCGGCTGTGCAAGCCGTACTCGGAGGTGTACGTG
CTGGACGCGGCCGGCCCGGGCGGGCTCGAGGGCCTGCGCGAGGCGCTGACGGCGACGCTGACGGACGTGTGCCGC
GGCATGGTGCCGCACTCGGTCGTCGTCGTGGACGGGCAGACGCTGGCGGCGGTCGAGGCGGACGCGGCCGGGCTG
GCGGCGCTGTTCGGCGACCTGGCCGTCCGCGTCGACTCGGTCATCTGCTGCCGGGCGTCGCCGGCGCAGAAGGCG
GCGCTGGTCAAGTCGATCCGGCGGCGGCTGGCCGGCAGCATGACGCTGGCGGTGGGCGACGGGGCCAACGACATC
GGCATGATCCAGGCGTCGCACGTCGGCGTCGGCATCTCGGGCCGCGAGGGCCTGCAGGCGGCGCGCATCGCCGAC
TACGCCGTCGCGCAGTTCCGCTTCCTGCAGCGGCTGCTGCTCGTCCACGGCCGCTGGAACTACATCCGCACGGGC
AAGTACGTGCTGGCGACGTTCTGGAAGGAGGTGCTCTTCTTCCTCGTCCAGGCGCACTACCAGCGCCTCGACGGC
TACTCGGGCACCTCGCTCTTCGAGTCGGCCAGCCTGACCGTCTTCAACACGGCCTTCACCTCGCTGCCCGTCATC
CTGCTCGGCATCTTCGAGCGCGACCTGGCGCCCGAGACGCTGCTGGCCTTCCCGGAGCTGTACGCCCTGGGCCAG
CGCCGGCTCGGCTTCAACTTCGCCCAGTACCTGGGCTGGATGCTCATGGCCGTCGCCGGCAGCTTCGTCATCTTC
TACACGGCCTACGGCACCGAGGCCCGCGCCCTCTTCACCAGCGACACGAGCCTGTTTGCCATGGGCAACATCTGC
TTCACCGTCGCCGTCGTCTTCATCAACGTCAAGCTGCTCGTGCTCGAGCTCCACTGCAAGACGGTCATCACCTTC
ACCGGCTTCGTCCTCTCCGTCGGCGGCTGGTTCCTCTGGAACGTGGTGCTGTCGTTCGTGTACGCCGAGTCGGCC
GGGCCGTACCCCGTCCGCGACGCCTTCTTCCACAACTTCGGCCGCCAGGCCTCGTGGACCTGA
Transcript >Hirsu2|4333
CTGCCCCTGACGCTCGCCAACGTCCTCTACCGCGGCTCCGTCCTGCGCAACACGGCCGAGGCCGTCGGCCTCGTC
GTCAACGCCGGCGAGGAGTGCAAGATCCGCCTCAACGCCAGCAAGAACGTCCGCGCCAAGAAGCCGGCCATGCAG
GCCGCCATCAACCGCATGGTCCTCTTCCAGATCGCCATCGTCGCCGGCCTCGCCGCCGGCCTGACCGTCGGCTAC
CACCTGTGGCGCCGCCGCGTCGAGGCCCGCTCGCCCTACCTCGACGGCGCCCGCGTGCCCATCCGCCAGGTCTTC
TTCGGCTACCTCGTCATGTTCAACACCCTCATCCCCCTCTCGCTCTACATCAGCATGGAGATCATCAAGATCGGC
CAGCTGCTCCTCATGCACGACGTCCACATGTACGACCCGGCCTCCGACACCCCCATGGTCGCCAACACCACCACC
ATCCTCGAGAACCTCGGCCAGGTCACCCACCTCTTCTCCGACAAGACCGGCACCATGACGGAGAACGTGATGCGC
TTCCGCAAGCTCAGCGTCGCCGGCGCCGCCTGCCTGCATCACCGCCGGCACCTCAACGATGACGACGACGACGGC
CACGACGACGACCGCCATGACCGTTCCAAGAACAACAAGGGCAAGTCGACGACGACGACGACGACGACGACGACG
ACGACGGTCGTGGAGGAGGGCGTGGAGGAGAAGGAGTCGTTTCACGGCCTCGGCGGCGTACACCACTTTTCCTCT
TCTTCTTCCTCTTCATCCGCGTCCCGTCGCGGCGAGATGAACACGCGGGAGCTGCTCGACTACATCCGCCACAAG
CCCAACACAACCTTCTCGCGCAAGGCCATGCACTTCCTCCTCTGCATCGCCCTGTGCCACACCTGCCTGCCCGAG
ACGGGCCCCGACGGCCGCATCGCCTACCAGGCCGCGTCTCCCGACGAGCTGGCCCTGGTCGAGGCCGCGCGCGAC
ATGGGCCTCGTCGTCGTCGACCGCCCCGCCCAGGCCATCCGGCTGCGGCGGCAGACGCGCGACGGCCAACCGGCC
CCGACCGAGACGTACCAGGTCCTCGACGTCATCGAGTTCAGCAGCCGCCGCAAGCGCATGTCCGTCGTCGTCCGC
ATGCCCGACGGCCGCCTCTGCCTCATCTGCAAGGGAGCCGACAACGTCATCACCTCGCGCCTGCGCCTGAGCCAC
CTGGCCCAGGAGAAGGCCCGCGCCATCGGCCGCCGCGCCAGCGTGCGCAAGACGTTCGAGCAGGAGCAGGCCATG
CGCCGCATGAGCGGCGGCAGCCTCCACGCCACGACGCCCCGGACCAGCCTCGCCGAGCGCCGCAAGCGGGCCAGC
GGCGGCGCCTCGCTCGACCTCGCCCGGCTGGCTGCCGCCGGGAGGGCGGGGCAAAAGACGACGATGATGATGCAG
GAAAGCGCGGTGACGCCGACAACGATGACGATGACGACGATGACGACGATGACGACGACGACGACGACGCCGCCG
CCCTTCTCGCCGACCCGAGGCTCGCCCGCCGACCCGGTGGTGTCGCGGAGCCCGAGGTGGAGCCTGGACGACTTC
GGCATCGCCGACTCCGGCGCCGGCGGCCCCGGACCAGGGGTCGGGCGGGTGGACGAGTCGCTGGCGGCCAACGAC
GCGTCCGTGTTCGAGCGGTGCTTCCAGCACGTCGACGACTTCGCGACGGACGGGCTGCGGACGCTGCTGTACGCG
TACCGCTACCTCGACGAGGAGTCGTACGCGCGGTGGAAGCGGCTGTACCGCGAGGCCGAGACGAGCCTGGTGGAC
CGCGAGCGGCTGGTGGAGGAGGCGGGCGAGCAGCTGGAGACGGGCCTCGAGCTGGCCGGGGCGACGGCCATCGAG
GACAAGCTGCAGGAGGGCGTGGCGGAGACGATCGACAAGCTGCGGCGGGCCGGGATCAAGGTGTGGATGCTGACG
GGCGACAAGCGCGAGACGGCCATCAACATCGGGCACTCGGCGCGGCTGTGCAAGCCGTACTCGGAGGTGTACGTG
CTGGACGCGGCCGGCCCGGGCGGGCTCGAGGGCCTGCGCGAGGCGCTGACGGCGACGCTGACGGACGTGTGCCGC
GGCATGGTGCCGCACTCGGTCGTCGTCGTGGACGGGCAGACGCTGGCGGCGGTCGAGGCGGACGCGGCCGGGCTG
GCGGCGCTGTTCGGCGACCTGGCCGTCCGCGTCGACTCGGTCATCTGCTGCCGGGCGTCGCCGGCGCAGAAGGCG
GCGCTGGTCAAGTCGATCCGGCGGCGGCTGGCCGGCAGCATGACGCTGGCGGTGGGCGACGGGGCCAACGACATC
GGCATGATCCAGGCGTCGCACGTCGGCGTCGGCATCTCGGGCCGCGAGGGCCTGCAGGCGGCGCGCATCGCCGAC
TACGCCGTCGCGCAGTTCCGCTTCCTGCAGCGGCTGCTGCTCGTCCACGGCCGCTGGAACTACATCCGCACGGGC
AAGTACGTGCTGGCGACGTTCTGGAAGGAGGTGCTCTTCTTCCTCGTCCAGGCGCACTACCAGCGCCTCGACGGC
TACTCGGGCACCTCGCTCTTCGAGTCGGCCAGCCTGACCGTCTTCAACACGGCCTTCACCTCGCTGCCCGTCATC
CTGCTCGGCATCTTCGAGCGCGACCTGGCGCCCGAGACGCTGCTGGCCTTCCCGGAGCTGTACGCCCTGGGCCAG
CGCCGGCTCGGCTTCAACTTCGCCCAGTACCTGGGCTGGATGCTCATGGCCGTCGCCGGCAGCTTCGTCATCTTC
TACACGGCCTACGGCACCGAGGCCCGCGCCCTCTTCACCAGCGACACGAGCCTGTTTGCCATGGGCAACATCTGC
TTCACCGTCGCCGTCGTCTTCATCAACGTCAAGCTGCTCGTGCTCGAGCTCCACTGCAAGACGGTCATCACCTTC
ACCGGCTTCGTCCTCTCCGTCGGCGGCTGGTTCCTCTGGAACGTGGTGCTGTCGTTCGTGTACGCCGAGTCGGCC
GGGCCGTACCCCGTCCGCGACGCCTTCTTCCACAACTTCGGCCGCCAGGCCTCGTGGACCTGA
Gene >Hirsu2|4333
CTGCCCCTGACGCTCGCCAACGTCCTCTACCGCGGCTCCGTCCTGCGCAACACGGCCGAGGCCGTCGGCCTCGTC
GTCAACGCCGGCGAGGAGTGCAAGATCCGCCTCAACGCCAGCAAGAACGTCCGCGCCAAGAAGCCGGCCATGCAG
GCCGCCATCAACCGCATGGTCCTCTTCCAGATCGCCATCGTCGCCGGCCTCGCCGCCGGCCTGACCGTCGGCTAC
CACCTGTGGCGCCGCCGCGTCGAGGCCCGCTCGCCCTACCTCGACGGCGCCCGCGTGCCCATCCGCCAGGTCTTC
TTCGGCTACCTCGTCATGTTCAACACCCTCATCCCCCTCTCGCTCTACATCAGCATGGAGATCATCAAGATCGGC
CAGCTGCTCCTCATGCACGACGTCCACATGTACGACCCGGCCTCCGACACCCCCATGGTCGCCAACACCACCACC
ATCCTCGAGAACCTCGGCCAGGTCACCCACCTCTTCTCCGACAAGACCGGCACCATGACGGAGAACGTGATGCGC
TTCCGCAAGCTCAGCGTCGCCGGCGCCGCCTGCCTGCATCACCGCCGGCACCTCAACGATGACGACGACGACGGC
CACGACGACGACCGCCATGACCGTTCCAAGAACAACAAGGGCAAGTCGACGACGACGACGACGACGACGACGACG
ACGACGGTCGTGGAGGAGGGCGTGGAGGAGAAGGAGTCGTTTCACGGCCTCGGCGGCGTACACCACTTTTCCTCT
TCTTCTTCCTCTTCATCCGCGTCCCGTCGCGGCGAGATGAACACGCGGGAGCTGCTCGACTACATCCGCCACAAG
CCCAACACAACCTTCTCGCGCAAGGCCATGCACTTCCTCCTCTGCATCGCCCTGTGCCACACCTGCCTGCCCGAG
ACGGGCCCCGACGGCCGCATCGCCTACCAGGCCGCGTCTCCCGACGAGCTGGCCCTGGTCGAGGCCGCGCGCGAC
ATGGGCCTCGTCGTCGTCGACCGCCCCGCCCAGGCCATCCGGCTGCGGCGGCAGACGCGCGACGGCCAACCGGCC
CCGACCGAGACGTACCAGGTCCTCGACGTCATCGAGTTCAGCAGCCGCCGCAAGCGCATGTCCGTCGTCGTCCGC
ATGCCCGACGGCCGCCTCTGCCTCATCTGCAAGGGAGCCGACAACGTCATCACCTCGCGCCTGCGCCTGAGCCAC
CTGGCCCAGGAGAAGGCCCGCGCCATCGGCCGCCGCGCCAGCGTGCGCAAGACGTTCGAGCAGGAGCAGGCCATG
CGCCGCATGAGCGGCGGCAGCCTCCACGCCACGACGCCCCGGACCAGCCTCGCCGAGCGCCGCAAGCGGGCCAGC
GGCGGCGCCTCGCTCGACCTCGCCCGGCTGGCTGCCGCCGGGAGGGCGGGGCAAAAGACGACGATGATGATGCAG
GAAAGCGCGGTGACGCCGACAACGATGACGATGACGACGATGACGACGATGACGACGACGACGACGACGCCGCCG
CCCTTCTCGCCGACCCGAGGCTCGCCCGCCGACCCGGTGGTGTCGCGGAGCCCGAGGTGGAGCCTGGACGACTTC
GGCATCGCCGACTCCGGCGCCGGCGGCCCCGGACCAGGGGTCGGGCGGGTGGACGAGTCGCTGGCGGCCAACGAC
GCGTCCGTGTTCGAGCGGTGCTTCCAGCACGTCGACGACTTCGCGACGGACGGGCTGCGGACGCTGCTGTACGCG
TACCGCTACCTCGACGAGGAGTCGTACGCGCGGTGGAAGCGGCTGTACCGCGAGGCCGAGACGAGCCTGGTGGAC
CGCGAGCGGCTGGTGGAGGAGGCGGGCGAGCAGCTGGAGACGGGCCTCGAGCTGGCCGGGGCGACGGCCATCGAG
GACAAGCTGCAGGAGGGCGTGGCGGAGACGATCGACAAGCTGCGGCGGGCCGGGATCAAGGTGTGGATGCTGACG
GGCGACAAGCGCGAGACGGCCATCAACATCGGGCACTCGGCGCGGCTGTGCAAGCCGTACTCGGAGGTGTACGTG
CTGGACGCGGCCGGCCCGGGCGGGCTCGAGGGCCTGCGCGAGGCGCTGACGGCGACGCTGACGGACGTGTGCCGC
GGCATGGTGCCGCACTCGGTCGTCGTCGTGGACGGGCAGACGCTGGCGGCGGTCGAGGCGGACGCGGCCGGGCTG
GCGGCGCTGTTCGGCGACCTGGCCGTCCGCGTCGACTCGGTCATCTGCTGCCGGGCGTCGCCGGCGCAGAAGGCG
GCGCTGGTCAAGTCGATCCGGCGGCGGCTGGCCGGCAGCATGACGCTGGCGGTGGGCGACGGGGCCAACGACATC
GGCATGATCCAGGCGTCGCACGTCGGCGTCGGCATCTCGGGCCGCGAGGGCCTGCAGGCGGCGCGCATCGCCGAC
TACGCCGTCGCGCAGTTCCGCTTCCTGCAGCGGCTGCTGCTCGTCCACGGCCGCTGGAACTACATCCGCACGGGC
AAGTACGTGCTGGCGACGTTCTGGAAGGAGGTGCTCTTCTTCCTCGTCCAGGCGCACTACCAGCGCCTCGACGGC
TACTCGGGCACCTCGCTCTTCGAGTCGGCCAGCCTGACCGTCTTCAACACGGCCTTCACCTCGCTGCCCGTCATC
CTGCTCGGCATCTTCGAGCGCGACCTGGCGCCCGAGACGCTGCTGGCCTTCCCGGAGCTGTACGCCCTGGGCCAG
CGCCGGCTCGGCTTCAACTTCGCCCAGTACCTGGGCTGGATGCTCATGGCCGTCGCCGGCAGCTTCGTCATCTTC
TACACGGCCTACGGCACCGAGGCCCGCGCCCTCTTCACCAGCGACACGAGCCTGTTTGCCATGGGCAACATCTGC
TTCACCGTCGCCGTCGTCTTCATCAACGTCAAGCTGCTGTGAGTTTTCGTCCCCCCTTCCGTCTGCGTTCCCTTG
CCCTACCCCTTGGGAGGCGTGTCCGTCCCCCGTGTCGACTCCGTGGCTGACTCGAACGCGGCAACGCAAGCGTGC
TCGAGCTCCACTGCAAGACGGTCATCACCTTCACCGGCTTCGTCCTCTCCGTCGGCGGCTGGTTCCTCTGGAACG
TGGTGCTGTCGTTCGTGTACGCCGAGTCGGCCGGGCCGTACCCCGTCCGCGACGCCTTCTTCCACAACTTCGGCC
GCCAGGCCTCGTGGTGGGCGGCCGTGCTGGTCGGCCTGGGCGCGCTGCTGGTCATGGAGCTGGCGGTGCAGGCGC
TGCGCCGCGTCTACTGGCCGACGGACCAGGACCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail