Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4331
Gene name
LocationContig_221:19488..21115
Strand+
Gene length (bp)1627
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03345 DDOST_48kD Oligosaccharyltransferase 48 kDa subunit beta 1.8E-154 26 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59866|OSTB_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit wbp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wbp1 PE=2 SV=2 35 449 1.0E-66
sp|Q6ZLK0|OST48_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Oryza sativa subsp. japonica GN=OST48 PE=2 SV=1 23 447 1.0E-58
sp|Q6NYS8|OST48_DANRE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Danio rerio GN=ddost PE=2 SV=2 9 451 2.0E-57
sp|B1H3C9|OST48_XENTR Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus tropicalis GN=ddost PE=2 SV=1 5 451 2.0E-54
sp|P48440|OST48_CHICK Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Gallus gallus GN=DDOST PE=1 SV=1 23 451 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59866|OSTB_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit wbp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wbp1 PE=2 SV=2 35 449 1.0E-66
sp|Q6ZLK0|OST48_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Oryza sativa subsp. japonica GN=OST48 PE=2 SV=1 23 447 1.0E-58
sp|Q6NYS8|OST48_DANRE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Danio rerio GN=ddost PE=2 SV=2 9 451 2.0E-57
sp|B1H3C9|OST48_XENTR Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus tropicalis GN=ddost PE=2 SV=1 5 451 2.0E-54
sp|P48440|OST48_CHICK Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Gallus gallus GN=DDOST PE=1 SV=1 23 451 4.0E-54
sp|P45971|OST48_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Caenorhabditis elegans GN=ostb-1 PE=3 SV=1 10 455 5.0E-54
sp|Q6GNR9|OST48_XENLA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus laevis GN=ddost PE=2 SV=1 23 451 2.0E-53
sp|O54734|OST48_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Mus musculus GN=Ddost PE=1 SV=2 11 451 7.0E-53
sp|Q641Y0|OST48_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Rattus norvegicus GN=Ddost PE=2 SV=1 19 451 2.0E-52
sp|Q5R501|OST48_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Pongo abelii GN=DDOST PE=2 SV=2 17 451 6.0E-52
sp|Q944K2|OST48_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Arabidopsis thaliana GN=OST48 PE=2 SV=1 36 447 7.0E-52
sp|P39656|OST48_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens GN=DDOST PE=1 SV=4 17 451 1.0E-51
sp|Q05052|OST48_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Canis lupus familiaris GN=DDOST PE=1 SV=1 19 451 2.0E-51
sp|A6QPY0|OST48_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Bos taurus GN=DDOST PE=2 SV=2 22 451 1.0E-50
sp|Q29381|OST48_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Sus scrofa GN=DDOST PE=1 SV=2 22 451 2.0E-50
sp|Q24319|OST48_DROME Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Drosophila melanogaster GN=Ost48 PE=2 SV=2 1 456 2.0E-48
sp|P33767|OSTB_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WBP1 PE=1 SV=1 1 452 1.0E-44
sp|Q54E62|OST48_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Dictyostelium discoideum GN=ddost PE=3 SV=1 4 447 3.0E-44
[Show less]

GO

GO Term Description Terminal node
GO:0018279 protein N-linked glycosylation via asparagine Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0044446 intracellular organelle part No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:0018196 peptidyl-asparagine modification No
GO:1901564 organonitrogen compound metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0006486 protein glycosylation No
GO:0044424 intracellular part No
GO:0044432 endoplasmic reticulum part No
GO:0019538 protein metabolic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0006487 protein N-linked glycosylation No
GO:0016020 membrane No
GO:0044425 membrane part No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0070085 glycosylation No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0044422 organelle part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 423 445 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4331
MRSLLSLVVLLFAAAAAALSTTGNRLLVVLDDAADKNAYTRFFGDLAARGFDISYETPRSEGLQLFRLGERSYDH
IIFFPTKVKGLGPNLTPSHLLDFVKAQGNILVALSSARPASTSIMSLLAELDMALPVERTGTVVDHFNYDAGSAA
EAHDVLVLDAPAGGVRPGLKDYFDMPGAVLALPRAAGHVLGPSQLLTPLLRAPATAYSYDPKEQARGVDPDELFA
AGGQLALTSAAQARNSARVAVLGSAEMLEDAWLEASVSRAGAAAKVAANREFAKRLTGWTFQEIGVLRVNDVEHR
LRGQNETNPDIYRIKNDVSYSISVSEYFWDKWLPFALPAGDKLQVEFSMLSPFHRLNLAPTLVTKTATVFGSNFT
LPDQHGIFNFRVNYKRPLLTYVDEKRTVSVRHMAHDEWPRSYDISGAWPWLSGIAATVSGFVAFCAVWMYSKPAD
KRAAKKA*
Coding >Hirsu2|4331
ATGCGGTCGCTTCTCAGCCTCGTTGTTCTACTTTTTGCCGCTGCGGCGGCGGCGCTCAGCACGACTGGCAACCGT
CTGCTGGTTGTGCTCGACGACGCGGCCGACAAGAATGCTTATACGCGCTTCTTCGGCGACCTTGCTGCGCGAGGC
TTCGACATCTCATACGAAACTCCTCGCAGCGAGGGGTTGCAGCTGTTCCGTCTCGGTGAGCGGAGCTACGACCAC
ATCATCTTCTTCCCGACAAAGGTCAAAGGTCTCGGACCGAACCTGACGCCGAGCCACCTCCTCGACTTCGTCAAG
GCGCAGGGCAACATCCTCGTGGCGCTGTCGTCGGCCAGGCCGGCCTCGACCTCGATCATGAGCCTGCTCGCCGAG
CTGGATATGGCGCTGCCGGTGGAGCGGACGGGCACCGTCGTCGACCACTTCAACTACGACGCCGGGTCGGCCGCT
GAGGCGCACGACGTGCTCGTGCTCGACGCCCCGGCCGGCGGCGTGCGGCCCGGCCTGAAGGACTACTTCGACATG
CCCGGCGCCGTGCTGGCCCTGCCGCGGGCCGCCGGCCACGTCCTCGGCCCGAGCCAGCTGCTGACGCCGCTGCTG
CGCGCCCCCGCCACCGCCTACAGCTACGACCCCAAGGAGCAGGCCCGCGGCGTCGACCCAGACGAGCTCTTCGCC
GCCGGCGGCCAGCTTGCCCTGACGTCGGCCGCTCAGGCACGCAACTCGGCCCGCGTCGCCGTCCTCGGCTCCGCC
GAGATGCTCGAGGACGCCTGGCTGGAGGCCAGCGTCTCGCGTGCCGGCGCCGCGGCCAAGGTCGCCGCGAACCGC
GAGTTTGCCAAGAGGCTGACGGGCTGGACCTTCCAGGAGATTGGCGTCTTGCGGGTCAACGACGTCGAGCACCGC
CTGCGGGGGCAGAACGAGACGAACCCGGACATCTACCGGATCAAGAACGACGTGTCGTACAGCATTTCGGTGTCG
GAGTACTTCTGGGACAAGTGGCTGCCCTTCGCGCTCCCGGCGGGCGACAAGCTGCAGGTCGAGTTCTCCATGCTG
TCGCCCTTCCACCGGCTCAACCTGGCGCCGACGCTGGTGACGAAGACGGCGACGGTGTTCGGCAGCAACTTCACG
CTGCCGGACCAGCACGGCATCTTCAACTTCCGGGTCAACTACAAGCGGCCGCTGCTGACGTACGTGGACGAGAAG
CGGACAGTCAGCGTGCGGCACATGGCGCACGACGAGTGGCCGCGCAGCTACGACATCTCGGGCGCCTGGCCGTGG
CTGTCGGGCATCGCGGCCACCGTGTCCGGCTTCGTGGCCTTTTGCGCTGTCTGGATGTACAGCAAGCCGGCCGAC
AAGCGGGCCGCCAAGAAGGCGTAG
Transcript >Hirsu2|4331
ATGCGGTCGCTTCTCAGCCTCGTTGTTCTACTTTTTGCCGCTGCGGCGGCGGCGCTCAGCACGACTGGCAACCGT
CTGCTGGTTGTGCTCGACGACGCGGCCGACAAGAATGCTTATACGCGCTTCTTCGGCGACCTTGCTGCGCGAGGC
TTCGACATCTCATACGAAACTCCTCGCAGCGAGGGGTTGCAGCTGTTCCGTCTCGGTGAGCGGAGCTACGACCAC
ATCATCTTCTTCCCGACAAAGGTCAAAGGTCTCGGACCGAACCTGACGCCGAGCCACCTCCTCGACTTCGTCAAG
GCGCAGGGCAACATCCTCGTGGCGCTGTCGTCGGCCAGGCCGGCCTCGACCTCGATCATGAGCCTGCTCGCCGAG
CTGGATATGGCGCTGCCGGTGGAGCGGACGGGCACCGTCGTCGACCACTTCAACTACGACGCCGGGTCGGCCGCT
GAGGCGCACGACGTGCTCGTGCTCGACGCCCCGGCCGGCGGCGTGCGGCCCGGCCTGAAGGACTACTTCGACATG
CCCGGCGCCGTGCTGGCCCTGCCGCGGGCCGCCGGCCACGTCCTCGGCCCGAGCCAGCTGCTGACGCCGCTGCTG
CGCGCCCCCGCCACCGCCTACAGCTACGACCCCAAGGAGCAGGCCCGCGGCGTCGACCCAGACGAGCTCTTCGCC
GCCGGCGGCCAGCTTGCCCTGACGTCGGCCGCTCAGGCACGCAACTCGGCCCGCGTCGCCGTCCTCGGCTCCGCC
GAGATGCTCGAGGACGCCTGGCTGGAGGCCAGCGTCTCGCGTGCCGGCGCCGCGGCCAAGGTCGCCGCGAACCGC
GAGTTTGCCAAGAGGCTGACGGGCTGGACCTTCCAGGAGATTGGCGTCTTGCGGGTCAACGACGTCGAGCACCGC
CTGCGGGGGCAGAACGAGACGAACCCGGACATCTACCGGATCAAGAACGACGTGTCGTACAGCATTTCGGTGTCG
GAGTACTTCTGGGACAAGTGGCTGCCCTTCGCGCTCCCGGCGGGCGACAAGCTGCAGGTCGAGTTCTCCATGCTG
TCGCCCTTCCACCGGCTCAACCTGGCGCCGACGCTGGTGACGAAGACGGCGACGGTGTTCGGCAGCAACTTCACG
CTGCCGGACCAGCACGGCATCTTCAACTTCCGGGTCAACTACAAGCGGCCGCTGCTGACGTACGTGGACGAGAAG
CGGACAGTCAGCGTGCGGCACATGGCGCACGACGAGTGGCCGCGCAGCTACGACATCTCGGGCGCCTGGCCGTGG
CTGTCGGGCATCGCGGCCACCGTGTCCGGCTTCGTGGCCTTTTGCGCTGTCTGGATGTACAGCAAGCCGGCCGAC
AAGCGGGCCGCCAAGAAGGCGTAG
Gene >Hirsu2|4331
ATGCGGTCGCTTCTCAGCCTCGTTGTTCTACTTTTTGCCGCTGCGGCGGCGGCGCTCAGCACGACTGGCAACCGT
CTGCTGGTTGTGCTCGACGACGCGGCCGACAAGAATGCTTATACGCGCTTCTTCGGCGACCTTGCTGGTGAGCTC
CGACGGGCTTCTGCGGGAGATGGAATAGGCCGCTAACGTGATGGGTCGCCTTTTTTTTTTGTAGCGCGAGGCTTC
GACATCTCATACGAAACTCCTCGCAGCGAGGGGTTGCAGCTGTTCCGTCTCGGTGAGCGGAGCTACGACCACATC
ATCTTCTTCCCGACAAAGGTCAAAGGTGGGCGCTCTTCTCCCCCCGCTTTTGCGCCTCTCTCGCCGCTCGTCTGA
CTCTTCCGCCTCCACCGCTTCCCACAGGTCTCGGACCGAACCTGACGCCGAGCCACCTCCTCGACTTCGTCAAGG
CGCAGGGCAACATCCTCGTGGCGCTGTCGTCGGCCAGGCCGGCCTCGACCTCGATCATGAGCCTGCTCGCCGAGC
TGGATATGGCGCTGCCGGTGGAGCGGACGGGCACCGTCGTCGACCACTTCAACTACGACGCCGGGTCGGCCGCTG
AGGCGCACGACGTGCTCGTGCTCGACGCCCCGGCCGGCGGCGTGCGGCCCGGCCTGAAGGACTACTTCGACATGC
CCGGCGCCGTGCTGGCCCTGCCGCGGGCCGCCGGCCACGTCCTCGGCCCGAGCCAGCTGCTGACGCCGCTGCTGC
GCGCCCCCGCCACCGCCTACAGCTACGACCCCAAGGAGCAGGCCCGCGGCGTCGACCCAGACGAGCTCTTCGCCG
CCGGCGGCCAGCTTGCCCTGACGTCGGCCGCTCAGGCACGCAACTCGGCCCGCGTCGCCGTCCTCGGCTCCGCCG
AGATGCTCGAGGACGCCTGGCTGGAGGCCAGCGTCTCGCGTGCCGGCGCCGCGGCCAAGGTCGCCGCGAACCGCG
AGTTTGCCAAGAGGCTGACGGGCTGGACCTTCCAGGAGATTGGCGTCTTGCGGGTCAACGACGTCGAGCACCGCC
TGCGGGGGCAGAACGAGACGAACCCGGACATCTACCGGATCAAGAACGACGTGGTGAGTTTTTTTTTATTGGCTC
TGTTCGTCGATGCTGGTAACCTGCCGGGGACTGCGAATTCCATGGGCTTGGGCTGCTGCTTCTGCTGACACGATG
TGCGCAGTCGTACAGCATTTCGGTGTCGGAGTACTTCTGGGACAAGTGGCTGCCCTTCGCGCTCCCGGCGGGCGA
CAAGCTGCAGGTCGAGTTCTCCATGCTGTCGCCCTTCCACCGGCTCAACCTGGCGCCGACGCTGGTGACGAAGAC
GGCGACGGTGTTCGGCAGCAACTTCACGCTGCCGGACCAGCACGGCATCTTCAACTTCCGGGTCAACTACAAGCG
GCCGCTGCTGACGTACGTGGACGAGAAGCGGACAGTCAGCGTGCGGCACATGGCGCACGACGAGTGGCCGCGCAG
CTACGACATCTCGGGCGCCTGGCCGTGGCTGTCGGGCATCGCGGCCACCGTGTCCGGCTTCGTGGCCTTTTGCGC
TGTCTGGATGTACAGCAAGCCGGCCGACAAGCGGGCCGCCAAGAAGGCGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail