Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4330
Gene name
LocationContig_221:18699..19037
Strand-
Gene length (bp)338
Transcript length (bp)234
Coding sequence length (bp)234
Protein length (aa) 78

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P42117|NDUA3_NEUCR NADH-ubiquinone oxidoreductase 9.5 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo9.5 PE=1 SV=3 1 77 4.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4330
MSSAAPLFWSTPIKYCRWAARERPALFWSVIIGAAGPVFLPFGAPIRRYFGDIDPEPIPVTYPVPSGPRKKLTGY
DD*
Coding >Hirsu2|4330
ATGTCGTCGGCCGCGCCGCTCTTCTGGTCCACGCCCATCAAGTACTGCCGCTGGGCGGCCCGCGAGCGCCCCGCC
CTCTTCTGGTCCGTCATCATCGGCGCCGCCGGCCCCGTCTTCCTGCCCTTCGGCGCCCCGATTCGACGTTACTTC
GGCGACATCGATCCCGAACCCATCCCAGTGACGTATCCCGTTCCCTCCGGTCCCCGCAAGAAGCTCACGGGCTAC
GATGACTAG
Transcript >Hirsu2|4330
ATGTCGTCGGCCGCGCCGCTCTTCTGGTCCACGCCCATCAAGTACTGCCGCTGGGCGGCCCGCGAGCGCCCCGCC
CTCTTCTGGTCCGTCATCATCGGCGCCGCCGGCCCCGTCTTCCTGCCCTTCGGCGCCCCGATTCGACGTTACTTC
GGCGACATCGATCCCGAACCCATCCCAGTGACGTATCCCGTTCCCTCCGGTCCCCGCAAGAAGCTCACGGGCTAC
GATGACTAG
Gene >Hirsu2|4330
ATGTCGTCGGCCGCGCCGCTCTTCTGGTCCACGCCCATCAAGTACTGCCGCTGGGCGGCCCGCGAGCGCCCCGCC
CTCTTCTGGTCCGTCATCATCGGCGCCGCCGGCCCCGTCTTCCTGCCCTTCGGCGCCCCGATTCGACGTTACTTC
GGCGACATCGATCCCGAACCCATCCCAGTGACGTATCCCGGTATGCGTCCCTCCGTCCGGGCCCGCCTCTGCTCT
CGTCGAGAGGACGGGCGGGCCGAGACAGGCTGAGAAAGAGCATCGGTCCCGCTGACTCTCACCCCCCAGTTCCCT
CCGGTCCCCGCAAGAAGCTCACGGGCTACGATGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail