Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4329
Gene name
LocationContig_221:10041..18242
Strand+
Gene length (bp)8201
Transcript length (bp)7656
Coding sequence length (bp)7656
Protein length (aa) 2552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02138 Beach Beige/BEACH domain 9.7E-118 1955 2234
PF14844 PH_BEACH PH domain associated with Beige/BEACH 3.9E-10 1836 1897
PF13385 Laminin_G_3 Concanavalin A-like lectin/glucanases superfamily 1.7E-09 378 500

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LKZ7|BPH1_SCHPO Beige protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lvs1 PE=1 SV=2 1277 2546 0.0E+00
sp|Q6VNB8|WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus GN=Wdfy3 PE=1 SV=1 1593 2489 1.0E-160
sp|Q8IZQ1|WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens GN=WDFY3 PE=1 SV=2 1564 2489 5.0E-159
sp|P25356|BPH1_YEAST Beige protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPH1 PE=1 SV=2 1605 2512 1.0E-147
sp|Q55DM1|LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum GN=lvsA PE=3 SV=2 1775 2488 5.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LKZ7|BPH1_SCHPO Beige protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lvs1 PE=1 SV=2 1277 2546 0.0E+00
sp|Q6VNB8|WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus GN=Wdfy3 PE=1 SV=1 1593 2489 1.0E-160
sp|Q8IZQ1|WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens GN=WDFY3 PE=1 SV=2 1564 2489 5.0E-159
sp|P25356|BPH1_YEAST Beige protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPH1 PE=1 SV=2 1605 2512 1.0E-147
sp|Q55DM1|LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum GN=lvsA PE=3 SV=2 1775 2488 5.0E-138
sp|Q6ZS81|WDFY4_HUMAN WD repeat- and FYVE domain-containing protein 4 OS=Homo sapiens GN=WDFY4 PE=1 SV=3 1539 2545 2.0E-133
sp|F4HZB2|BCHA1_ARATH Protein SPIRRIG OS=Arabidopsis thaliana GN=SPI PE=1 SV=1 1443 2489 9.0E-133
sp|F4JHT3|BCHA2_ARATH BEACH domain-containing protein A2 OS=Arabidopsis thaliana GN=BCHA2 PE=3 SV=1 1705 2489 2.0E-131
sp|Q86JF2|LVSB_DICDI BEACH domain-containing protein lvsB OS=Dictyostelium discoideum GN=lvsB PE=3 SV=1 1846 2505 2.0E-116
sp|P97412|LYST_MOUSE Lysosomal-trafficking regulator OS=Mus musculus GN=Lyst PE=1 SV=1 1842 2544 5.0E-101
sp|Q9TTK4|LYST_BOVIN Lysosomal-trafficking regulator OS=Bos taurus GN=LYST PE=1 SV=1 1831 2302 4.0E-88
sp|Q6ZQA0|NBEL2_MOUSE Neurobeachin-like protein 2 OS=Mus musculus GN=Nbeal2 PE=1 SV=2 1859 2246 1.0E-87
sp|Q6ZNJ1|NBEL2_HUMAN Neurobeachin-like protein 2 OS=Homo sapiens GN=NBEAL2 PE=1 SV=2 1602 2246 1.0E-87
sp|Q99698|LYST_HUMAN Lysosomal-trafficking regulator OS=Homo sapiens GN=LYST PE=1 SV=3 1830 2302 3.0E-87
sp|E7FAW3|NBEL2_DANRE Neurobeachin-like protein 2 OS=Danio rerio GN=nbeal2 PE=1 SV=1 1859 2234 4.0E-87
sp|Q6ZS30|NBEL1_HUMAN Neurobeachin-like protein 1 OS=Homo sapiens GN=NBEAL1 PE=2 SV=3 1851 2251 3.0E-86
sp|F4I9T0|BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana GN=BCHB PE=3 SV=1 1849 2234 5.0E-86
sp|Q54U63|LVSC_DICDI BEACH domain-containing protein lvsC OS=Dictyostelium discoideum GN=lvsC PE=3 SV=2 1849 2231 1.0E-85
sp|Q9W4E2|NBEA_DROME Neurobeachin OS=Drosophila melanogaster GN=rg PE=1 SV=3 1851 2400 2.0E-85
sp|Q9EPN1|NBEA_MOUSE Neurobeachin OS=Mus musculus GN=Nbea PE=1 SV=1 1851 2234 4.0E-84
sp|Q8NFP9|NBEA_HUMAN Neurobeachin OS=Homo sapiens GN=NBEA PE=1 SV=3 1851 2234 8.0E-84
sp|P50851|LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens GN=LRBA PE=1 SV=4 1851 2234 8.0E-83
sp|F4IG73|BCHC2_ARATH BEACH domain-containing protein C2 OS=Arabidopsis thaliana GN=BCHC2 PE=1 SV=1 1841 2234 3.0E-82
sp|Q9ESE1|LRBA_MOUSE Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus GN=Lrba PE=1 SV=1 1851 2400 3.0E-82
sp|Q55AV3|LVSD_DICDI BEACH domain-containing protein lvsD OS=Dictyostelium discoideum GN=lvsD PE=3 SV=2 1847 2401 2.0E-81
sp|Q54RQ8|LVSE_DICDI BEACH domain-containing protein lvsE OS=Dictyostelium discoideum GN=lvsE PE=3 SV=1 1851 2238 4.0E-79
sp|Q54PP7|LVSF_DICDI BEACH domain-containing protein lvsF OS=Dictyostelium discoideum GN=lvsF PE=3 SV=1 1822 2234 4.0E-75
sp|Q92636|FAN_HUMAN Protein FAN OS=Homo sapiens GN=NSMAF PE=1 SV=2 1954 2234 3.0E-72
sp|O35242|FAN_MOUSE Protein FAN OS=Mus musculus GN=Nsmaf PE=1 SV=2 1954 2234 6.0E-72
sp|Q19317|NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans GN=sel-2 PE=2 SV=3 1847 2234 3.0E-71
sp|A8XSV3|NBEA_CAEBR Putative neurobeachin homolog OS=Caenorhabditis briggsae GN=sel-2 PE=3 SV=1 1847 2234 3.0E-71
sp|Q7LKZ7|BPH1_SCHPO Beige protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lvs1 PE=1 SV=2 316 1011 9.0E-43
sp|F4JD14|BCHC1_ARATH BEACH domain-containing protein C1 OS=Arabidopsis thaliana GN=BCHC1 PE=1 SV=1 1836 2103 7.0E-41
sp|F4JY12|GFS12_ARATH Protein GFS12 OS=Arabidopsis thaliana GN=GFS12 PE=1 SV=1 1950 2234 5.0E-24
sp|Q8IZQ1|WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens GN=WDFY3 PE=1 SV=2 367 891 4.0E-21
sp|Q6VNB8|WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus GN=Wdfy3 PE=1 SV=1 367 891 2.0E-19
sp|Q5ND34|WDR81_MOUSE WD repeat-containing protein 81 OS=Mus musculus GN=Wdr81 PE=1 SV=2 1957 2234 2.0E-19
sp|Q562E7|WDR81_HUMAN WD repeat-containing protein 81 OS=Homo sapiens GN=WDR81 PE=1 SV=2 1957 2234 5.0E-19
sp|D4A929|WDR81_RAT WD repeat-containing protein 81 OS=Rattus norvegicus GN=Wdr81 PE=3 SV=1 1957 2234 9.0E-19
sp|Q99698|LYST_HUMAN Lysosomal-trafficking regulator OS=Homo sapiens GN=LYST PE=1 SV=3 2290 2544 2.0E-12
sp|Q9TTK4|LYST_BOVIN Lysosomal-trafficking regulator OS=Bos taurus GN=LYST PE=1 SV=1 2290 2505 3.0E-12
sp|Q10122|YSM1_CAEEL Uncharacterized WD repeat-containing protein F52C9.1 OS=Caenorhabditis elegans GN=F52C9.1 PE=3 SV=2 1953 2234 2.0E-10
sp|F4JHT3|BCHA2_ARATH BEACH domain-containing protein A2 OS=Arabidopsis thaliana GN=BCHA2 PE=3 SV=1 368 504 3.0E-07
sp|Q55FJ0|LVSG_DICDI Probable inactive serine/threonine-protein kinase lvsG OS=Dictyostelium discoideum GN=lvsG PE=3 SV=1 1953 2010 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 105 122 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4329
MASHPRRYRSSTSASAQPSSKSFQVLRALLDDLADDAASPGTNGYPPVGTLCRSLTKISQHVASAPQPAVQDDFR
HADGFQALLDLLHCFSGYYDPHKRTETEMLALFRLLGACLGVLSAALRRHSGNKRFFRYRVQDGGWETLEQVLAS
IGLGGAELDPWVSCHVFGKLLSFALDDDGLDLLCQSIAKALRPEAAASSGSCAGREGSVPAGDGNDGDEEQWDLV
LMRSTENIGPSVREVVHSRTVVYFPEIIRPVISFWTNIPRPHGSTANPSSVIVLETILRASSLSLYNRAAVHSTG
VLSQFLQVAFGQRSWLADSERETLLAICKTLMFLGVNQPADTQFLLSTPGPGASDFCLDMMSEYAGPPFFHFDLS
LSGHSSIELPSLGRAFPPQSTAGYTFTAWIRIESFDPAAHTTVFGVFDASQTCFVLMYLEKDTRNFILQTSVFSS
KPSVRFKSVVFREKKWYHVAVVHRRPKTMTASKASLYVNGDFAEQIRCSYPHVPPLLNGSNESFASFNPSQGRTN
PVQAFLGTPRELSGRTGPGVVSSQWSLASAHLFEDVLSDDYLAVHYGLGPRYQGNFQDSLGGFQTYEASATLGLR
NEIVHPGKDEGSDILRAVREKASSLLPESKILLSVIPSATFPEHVQYLDTGVLRSLPRSSLRSLFHLSNQEGSPL
AVNCTVSSLSDALLRTHGVASLRGNPVVAVPSHLDENLWRLAGFTPLALKLLERASTAEDTVRAIEIMFYCIRKS
WRNSEAMERDNGYSILGMILRFKIGHGNYSTGDLPVSRLLISNEERDSLTFRVLSLVLGFVGYNHVDPIESFIVN
PLAYRILLIDLDIWRRSAQRTQELFYKQFVTFAVNSKHHEFNSRRLIRMRIVKRLLDAMKGEGVSEDVSGHFMDA
FGALVKSNLSQEVMRAMSLFITLLSKKQLGIRVLTMYCGILCEKGNFNNIKKFARTVTNKWLLYLLADEDAVVVL
HGCKILSRLLVAHGSSYTAKFSGKSGGFTIMANRLKKFWDIPTLWTVLFSVLFGCDVADIGFDRGFDEQSLLGLF
GGRKVVYPECLITITSLLQHGLKEVMRYQEDPDSPAKTDDFSSATPKARLKPEAGDVELSMNLAKAVESRSTFSR
DHERVANHACVLSTIVRFLQALQAQSPDFRDFALSSEWVRLLLLALYPVIVSSDAVTPDVELNSRDSTLTFEGSD
VIIRPIGGCPAATPIVRTSSVDVVPSPQATPPKGTPLRRASSFVLLTAQSVSRADTRPPAPSPQLQPGQSSGSAL
SEALLDLLLSVFMDQVFTRKDFAGLGLFSKVPPGFQEHQAYLESYILKRVVAKVSDRVHSSGKAICEPRTLTNLS
RLCSHLSEAIFEGWFIDGAEVMIDFSGMLLELLQRPDVSKLKSVRLCSQAVATIRSCFLRIILLKLSDLDNPRIG
EKEAKDFMNKLAYWQMSILECFSSEDDYLKLFWYQLYTKLIDDKLSIRIAAANFLRIVLVQKPDESVAVIRSCMA
PDQRKLSREFQKLTEVDDETFVVWVDQHRPSLDGLFFGSMAKTWEDFVSVENQRTFETARGRLSKRKERLKTWNS
EAVSAEKILVNHEVGNSAWMKSIYNSEHFKYQRQLQDQQDDLSFLTSAYSKMERDLRRPGAVFSEPSSLKWKLDR
TEGRNRMRLRLLPDSSAAEEAYQPKRKGAAAELRGGNTPAAAPSANGPPEVRPPSASLDGNDDSSSLNPEPAPST
DQTDSGYAPEDDFELVDDPNDPNEGDETFEDKNRKVMRRLEHGEQVQAAYNMSRITGLEACEGLLIVGKDALYIM
DNVFQCANGDIVNVWQAPSEERDPFTMVVTGAKTLERRQNSGARDQESRHWRWHDVISVSKRRFLFRDVAIEIFF
TDGRSYLLTTINSAVRDELFAKMLSKASHTSAPNALPNPEDAWRLEALKAYEEFPQGFGAGLGSRLGTLFNASSW
NPAMKRWQRGELSNFHYLMMVNTMAGRTFNDLTQYPVFPWVLADYTSEDLDLEDPATFRDLSKPMGAQTPGRVPD
FVETYNALREIGQTPFHYGTHYSSAMIVSSYLIRLPPFVQSYLLVQGDSFDHADRLFQSVGDAWKSASCRNKTDV
RELIPEFFCLPEFLTNINGYDFGNRQSNGAKVDSVALPPWAKGDPKIFIAKHREALESPYVSENLHHWIDLVFGQ
KQRGEAAVENLNVFHHLSYAGASDLDRITDANERAITAGVIHNFGQTPHQVFAKPHPAREHMRCPIKRLDSGVFS
LRCLEHPLLESHDRVASLVYAPKSDRLLCASPLRLNLPPYDKFLEWGYADGSIRFFFSDNRKPAGLFENLHIGQI
SCACFADSKTLITAGEDCVVSVYSVRTAPGKQVDLLPRSSVFGHKTPVTAMAVSKAFSTFVTASSDGQAFLWDLN
QLSFIRKLPLVRQAECACINDVSGEILLCSGPNVLLYTLNGSLILDQNVCTEQDDYVHSCAFYEGAGDEWLENQL
IFTGHSRGRVNIWRKGIAAGKWTLELLRRLDHADGKSDEGENTEAGITCITPMPTCVYTGDDEGRVYEWNLGRGD
R*
Coding >Hirsu2|4329
ATGGCCTCTCACCCTCGACGGTACCGCTCCTCGACCTCGGCCTCGGCCCAGCCGTCGTCCAAGTCGTTCCAAGTC
CTGCGCGCCTTGCTCGACGACCTCGCCGACGATGCCGCCTCGCCCGGCACCAACGGATACCCCCCGGTGGGCACG
CTGTGCAGGAGCCTGACCAAGATTTCTCAACATGTCGCCTCTGCGCCTCAGCCCGCCGTCCAGGACGACTTCCGC
CACGCCGACGGCTTCCAAGCCCTCCTCGACCTTCTGCACTGCTTTTCCGGCTACTACGACCCGCACAAACGAACC
GAAACTGAAATGCTTGCCCTCTTCAGGCTGCTGGGAGCCTGCCTCGGCGTCCTGTCGGCCGCGCTGAGGCGCCAC
TCGGGCAACAAGCGCTTCTTCCGCTACCGAGTCCAGGACGGCGGCTGGGAGACGCTCGAGCAGGTGCTCGCGAGC
ATCGGGCTGGGTGGCGCCGAGCTCGACCCCTGGGTGAGCTGCCACGTCTTCGGCAAATTGCTGTCCTTTGCCCTC
GACGACGACGGCCTGGACCTGCTCTGCCAGTCCATTGCCAAAGCGCTGCGCCCGGAGGCTGCCGCCAGCTCGGGC
AGCTGCGCCGGCCGAGAGGGCAGCGTGCCCGCCGGTGACGGCAACGACGGCGACGAAGAGCAGTGGGACCTCGTC
CTGATGCGCTCCACCGAGAACATCGGCCCCAGCGTCAGAGAAGTCGTGCATTCCAGGACCGTCGTTTATTTTCCC
GAAATAATCAGGCCCGTCATCAGCTTCTGGACCAACATCCCCCGGCCCCACGGCTCCACGGCGAACCCCAGCTCC
GTCATCGTCCTGGAAACCATCTTGCGCGCATCCTCTTTGTCGCTCTACAACCGCGCCGCCGTCCACTCCACCGGC
GTACTGTCCCAGTTCCTCCAGGTCGCCTTTGGGCAGCGCTCCTGGCTTGCCGACTCGGAGCGCGAGACACTCTTG
GCCATCTGCAAGACGCTCATGTTTCTCGGCGTAAACCAGCCGGCCGACACGCAGTTTCTGCTGTCGACGCCGGGG
CCGGGAGCCTCCGACTTCTGTCTGGACATGATGTCCGAATATGCCGGCCCGCCCTTCTTCCATTTCGATCTGTCT
CTCAGCGGTCACTCGTCCATTGAGCTGCCCAGCCTCGGCCGCGCGTTTCCCCCGCAGTCGACGGCTGGCTACACC
TTCACGGCCTGGATTCGCATCGAGTCCTTTGACCCGGCCGCCCACACCACCGTCTTCGGCGTCTTCGATGCGTCT
CAGACGTGCTTCGTGCTCATGTATCTGGAAAAGGATACCCGCAACTTCATTCTGCAAACGTCCGTCTTCTCTAGC
AAGCCGAGTGTGAGATTCAAATCCGTTGTGTTTCGTGAGAAGAAGTGGTACCACGTCGCCGTCGTCCACAGGCGG
CCCAAAACCATGACCGCCAGCAAGGCATCCCTCTACGTCAACGGGGACTTTGCCGAGCAGATCCGGTGCAGCTAT
CCTCACGTGCCGCCGCTTCTCAACGGCAGCAACGAAAGCTTTGCCTCGTTCAACCCGAGCCAGGGCAGGACCAAC
CCGGTCCAGGCCTTCCTTGGTACACCCCGTGAGCTCTCCGGCCGCACCGGGCCCGGCGTCGTCTCATCACAGTGG
TCGCTCGCCTCGGCCCATCTGTTCGAGGACGTCCTGAGTGACGATTACTTGGCCGTCCACTACGGCCTCGGCCCT
CGCTATCAGGGCAACTTCCAGGATAGCCTCGGGGGTTTTCAGACATACGAGGCGTCTGCCACTTTGGGTCTTCGC
AATGAAATCGTCCATCCCGGCAAAGACGAAGGCTCGGATATCCTGCGAGCCGTCCGCGAGAAAGCAAGCTCACTC
CTCCCGGAGTCCAAGATTCTCCTCAGCGTCATCCCTTCTGCCACCTTTCCCGAACACGTGCAGTATCTCGACACG
GGCGTGTTGCGTTCCCTGCCCCGCTCGTCTCTGCGCAGCCTTTTCCACCTGTCTAACCAGGAAGGGTCGCCGCTC
GCCGTCAACTGCACAGTCTCGAGTCTGTCGGACGCCCTCTTGCGGACCCATGGGGTCGCGTCCCTTCGTGGGAAC
CCCGTCGTTGCCGTGCCATCGCACTTGGACGAAAACCTCTGGCGCCTTGCCGGCTTCACGCCTCTGGCCCTCAAG
CTGCTGGAGCGGGCCTCTACGGCGGAAGACACCGTCCGCGCCATCGAAATCATGTTCTACTGCATCCGCAAGAGC
TGGCGCAACAGCGAGGCCATGGAGCGAGACAATGGCTACAGCATCTTGGGCATGATCCTGCGATTCAAGATCGGC
CACGGGAACTACTCGACGGGCGACCTCCCCGTCTCTCGCTTGCTGATATCCAATGAGGAGCGTGACAGTCTGACA
TTCCGCGTGCTCAGCCTGGTGCTCGGCTTTGTCGGCTACAACCACGTCGACCCCATTGAGTCGTTCATCGTCAAC
CCCCTCGCCTACCGAATTCTTCTCATCGACCTGGACATCTGGCGACGATCTGCCCAACGCACACAGGAGCTTTTC
TACAAGCAGTTTGTGACATTCGCCGTTAACAGTAAACACCACGAATTCAATAGCAGGAGGTTGATCCGAATGCGA
ATCGTTAAGAGACTCCTTGACGCTATGAAGGGCGAGGGCGTGTCGGAGGACGTTTCGGGCCACTTTATGGATGCC
TTCGGAGCTCTGGTCAAGTCGAACCTGAGCCAAGAAGTTATGAGGGCAATGTCGCTGTTCATCACGTTACTCTCG
AAGAAACAGCTTGGCATACGGGTCTTGACCATGTACTGCGGCATTCTGTGCGAGAAGGGCAACTTTAACAACATC
AAGAAGTTCGCTCGAACGGTGACCAACAAGTGGCTCCTCTACTTGCTGGCAGACGAGGACGCCGTTGTCGTCCTT
CATGGATGCAAGATTCTGTCTCGGCTCCTCGTGGCTCATGGGTCCTCGTATACCGCCAAATTCTCGGGCAAATCC
GGAGGCTTCACCATCATGGCGAACCGGCTCAAGAAGTTCTGGGATATACCCACGCTCTGGACGGTATTATTTAGC
GTCTTGTTCGGATGCGACGTCGCAGACATTGGATTTGATCGAGGCTTTGATGAGCAGAGCCTCCTCGGGCTATTT
GGCGGCCGAAAGGTCGTCTACCCCGAGTGCCTCATTACCATCACTTCCTTGCTCCAGCATGGCTTGAAGGAGGTC
ATGAGGTATCAGGAAGATCCTGACTCTCCCGCTAAGACGGACGATTTCTCCTCTGCTACTCCGAAAGCCCGGTTG
AAGCCTGAGGCTGGAGACGTGGAGCTATCCATGAACTTGGCCAAGGCGGTCGAATCCCGATCAACTTTCTCCAGA
GACCATGAACGAGTGGCCAACCATGCTTGTGTCTTGTCGACGATAGTACGATTTCTGCAAGCGCTCCAAGCACAG
TCCCCCGACTTCCGAGACTTTGCCCTGTCCTCGGAGTGGGTTCGCCTGCTCCTTCTCGCGCTTTATCCCGTCATC
GTCAGCTCAGATGCGGTCACGCCGGATGTCGAGCTGAACTCGCGAGACTCGACTCTCACCTTTGAAGGCAGCGAT
GTCATCATCAGGCCCATCGGGGGCTGCCCCGCCGCCACTCCCATTGTGCGGACGAGCAGTGTGGACGTTGTGCCA
TCGCCGCAGGCAACACCTCCCAAGGGCACGCCGCTCCGTCGAGCTTCATCTTTCGTCCTGCTCACGGCGCAGTCG
GTGTCACGCGCCGACACCCGCCCGCCGGCACCTTCTCCGCAACTGCAACCCGGCCAGAGCAGCGGCAGCGCCCTC
TCAGAGGCACTGCTCGACTTGCTGCTCAGCGTCTTCATGGACCAGGTCTTCACGCGGAAAGACTTTGCAGGCCTC
GGCCTCTTCAGCAAGGTGCCGCCTGGGTTCCAGGAACACCAGGCGTACCTCGAGTCGTACATTCTGAAAAGAGTC
GTCGCCAAGGTGTCGGACCGCGTCCATTCGAGCGGAAAGGCGATATGCGAGCCTCGCACCCTCACCAACCTGTCT
CGGCTCTGCTCGCACCTGTCCGAAGCAATATTCGAGGGCTGGTTCATTGACGGGGCAGAGGTCATGATCGACTTC
AGCGGCATGCTGCTGGAGCTGCTCCAGCGGCCCGACGTCTCGAAGCTGAAGAGCGTTCGCCTGTGCAGCCAGGCC
GTCGCCACGATCCGCAGCTGCTTCCTGAGGATCATTCTGCTGAAACTGTCGGACCTGGACAACCCCCGGATCGGA
GAGAAGGAGGCGAAGGATTTCATGAACAAGCTCGCTTACTGGCAAATGTCCATACTCGAGTGCTTCTCGTCGGAA
GACGACTACCTCAAGCTGTTTTGGTACCAGCTCTACACGAAACTCATCGACGACAAGCTGTCCATACGGATCGCC
GCGGCCAACTTCTTGCGCATCGTGCTGGTTCAGAAACCGGACGAGTCCGTGGCCGTGATCCGCTCGTGCATGGCT
CCGGACCAGCGCAAGCTATCGAGGGAGTTTCAGAAGCTGACCGAGGTTGACGACGAGACGTTCGTGGTGTGGGTG
GATCAACATCGGCCCTCTCTGGACGGGCTCTTCTTCGGCAGCATGGCCAAGACGTGGGAGGACTTTGTCAGCGTC
GAGAACCAAAGGACGTTTGAGACGGCCAGAGGGCGCCTCTCGAAGCGCAAGGAGCGGCTCAAGACGTGGAACTCG
GAAGCGGTCAGCGCGGAGAAGATACTCGTGAACCACGAGGTGGGCAACAGCGCGTGGATGAAGAGCATTTACAAC
TCGGAGCACTTCAAGTACCAGCGCCAATTGCAAGACCAACAGGACGACTTGTCGTTCCTCACGTCGGCCTATAGC
AAGATGGAGCGAGACCTCCGGAGGCCGGGTGCGGTCTTCAGCGAACCCTCCTCGCTCAAGTGGAAACTGGACCGG
ACGGAGGGGCGCAATCGGATGCGGCTGAGGCTGCTGCCAGACTCGTCGGCCGCTGAAGAAGCCTACCAGCCCAAG
AGGAAAGGGGCCGCCGCCGAGCTGCGAGGAGGCAACACGCCCGCCGCCGCCCCATCCGCGAACGGTCCGCCCGAG
GTACGGCCGCCGTCTGCCAGCCTCGACGGCAACGACGACTCATCCTCTCTCAACCCCGAGCCTGCACCGTCAACG
GATCAGACGGATTCGGGGTACGCCCCGGAAGACGACTTTGAGCTTGTTGACGACCCAAACGACCCCAACGAGGGA
GACGAGACGTTCGAAGACAAGAACCGCAAGGTCATGCGGCGACTCGAACACGGCGAGCAGGTACAGGCTGCCTAC
AACATGTCACGCATCACCGGTCTCGAGGCCTGCGAGGGCCTGCTCATCGTCGGCAAAGACGCCCTCTACATCATG
GACAACGTCTTCCAGTGCGCCAACGGGGACATTGTCAATGTGTGGCAGGCGCCGTCGGAGGAGCGCGACCCCTTC
ACCATGGTCGTCACCGGGGCCAAGACGCTGGAGCGACGCCAGAATTCCGGAGCCAGAGATCAGGAGTCGAGGCAC
TGGAGGTGGCATGACGTGATCAGTGTCTCCAAGCGCCGCTTCCTTTTCCGAGACGTCGCCATTGAGATCTTCTTC
ACCGACGGACGGAGCTATCTGCTGACGACGATCAACTCCGCCGTGCGGGACGAGCTGTTCGCCAAGATGCTCAGC
AAAGCGTCCCACACGAGCGCCCCCAACGCGCTCCCGAACCCCGAAGACGCCTGGAGGCTCGAGGCCCTGAAGGCG
TATGAGGAGTTCCCGCAGGGCTTCGGGGCGGGTCTCGGGTCCAGGCTCGGCACCCTGTTCAACGCATCCTCGTGG
AACCCGGCCATGAAGCGGTGGCAGCGGGGCGAGCTGTCCAACTTCCATTACCTGATGATGGTCAACACCATGGCC
GGCAGGACGTTCAACGACCTGACGCAATACCCCGTCTTCCCCTGGGTCCTCGCAGACTACACCAGCGAGGACCTG
GACCTGGAAGACCCGGCGACGTTCCGGGACCTCTCGAAGCCGATGGGCGCGCAGACGCCCGGGCGCGTCCCCGAC
TTCGTGGAGACGTACAACGCGCTGCGGGAGATCGGCCAGACGCCATTCCACTACGGCACTCACTACTCCTCGGCC
ATGATAGTTTCCTCGTACCTGATCCGCCTCCCGCCCTTTGTGCAGTCGTACCTGCTCGTGCAGGGCGACAGCTTT
GACCACGCGGATCGCCTGTTCCAGTCCGTCGGGGACGCGTGGAAGTCGGCCTCATGCAGGAACAAGACGGACGTG
AGGGAGCTGATCCCCGAGTTCTTTTGCTTGCCCGAATTCCTGACCAACATCAACGGCTACGACTTTGGGAACCGC
CAGAGCAACGGGGCCAAGGTCGACAGCGTGGCCCTGCCGCCCTGGGCCAAGGGCGACCCCAAGATCTTCATCGCC
AAGCACCGCGAGGCGCTCGAGAGCCCGTACGTGAGCGAGAACCTGCACCACTGGATAGACCTCGTGTTCGGCCAG
AAGCAGCGGGGCGAGGCGGCCGTCGAGAACCTCAACGTCTTCCACCACCTTTCGTACGCCGGGGCCAGCGACTTG
GACCGCATCACGGACGCCAACGAGCGGGCCATCACCGCGGGTGTCATCCACAACTTCGGCCAGACGCCTCACCAG
GTCTTCGCCAAACCGCACCCCGCCCGAGAGCATATGCGGTGCCCGATCAAGAGGCTCGACTCCGGCGTCTTCTCG
CTGAGGTGCTTGGAGCATCCGCTGCTCGAAAGCCACGACCGAGTAGCATCCCTCGTGTACGCCCCCAAGTCCGAC
CGACTCCTCTGCGCGTCCCCTCTCCGTCTCAACCTGCCGCCGTACGACAAGTTTCTGGAGTGGGGATACGCAGAC
GGCAGTATTCGCTTCTTCTTCAGCGACAATCGCAAGCCGGCTGGTCTGTTCGAGAATCTTCACATCGGCCAGATC
TCGTGCGCCTGCTTTGCCGATTCCAAGACGCTGATCACGGCGGGCGAGGACTGCGTGGTATCCGTGTACTCGGTG
CGCACGGCGCCGGGGAAACAGGTCGACCTGTTGCCCAGGTCCAGCGTCTTTGGGCACAAGACGCCGGTGACGGCC
ATGGCAGTCAGCAAGGCATTCAGCACCTTCGTGACGGCGTCGTCGGACGGGCAGGCGTTTCTGTGGGACCTCAAC
CAGCTGTCGTTCATACGGAAGCTGCCCCTGGTCCGGCAGGCCGAGTGCGCGTGCATCAACGACGTGTCGGGGGAG
ATCCTGCTGTGCTCGGGGCCGAACGTGCTGCTGTACACGCTCAACGGCTCGCTGATACTGGACCAGAACGTGTGC
ACGGAGCAGGACGACTACGTCCATTCGTGCGCCTTCTACGAGGGTGCCGGGGACGAGTGGCTGGAGAACCAGCTC
ATCTTCACCGGGCACAGCCGCGGCCGTGTCAACATCTGGCGCAAGGGCATCGCGGCGGGCAAGTGGACGCTGGAA
CTGCTGCGCCGGCTGGACCATGCCGACGGCAAGAGCGACGAGGGGGAGAACACGGAGGCCGGCATCACGTGCATC
ACGCCGATGCCGACATGCGTGTACACCGGGGACGACGAGGGCCGCGTGTACGAGTGGAACTTGGGACGAGGGGAC
AGATAG
Transcript >Hirsu2|4329
ATGGCCTCTCACCCTCGACGGTACCGCTCCTCGACCTCGGCCTCGGCCCAGCCGTCGTCCAAGTCGTTCCAAGTC
CTGCGCGCCTTGCTCGACGACCTCGCCGACGATGCCGCCTCGCCCGGCACCAACGGATACCCCCCGGTGGGCACG
CTGTGCAGGAGCCTGACCAAGATTTCTCAACATGTCGCCTCTGCGCCTCAGCCCGCCGTCCAGGACGACTTCCGC
CACGCCGACGGCTTCCAAGCCCTCCTCGACCTTCTGCACTGCTTTTCCGGCTACTACGACCCGCACAAACGAACC
GAAACTGAAATGCTTGCCCTCTTCAGGCTGCTGGGAGCCTGCCTCGGCGTCCTGTCGGCCGCGCTGAGGCGCCAC
TCGGGCAACAAGCGCTTCTTCCGCTACCGAGTCCAGGACGGCGGCTGGGAGACGCTCGAGCAGGTGCTCGCGAGC
ATCGGGCTGGGTGGCGCCGAGCTCGACCCCTGGGTGAGCTGCCACGTCTTCGGCAAATTGCTGTCCTTTGCCCTC
GACGACGACGGCCTGGACCTGCTCTGCCAGTCCATTGCCAAAGCGCTGCGCCCGGAGGCTGCCGCCAGCTCGGGC
AGCTGCGCCGGCCGAGAGGGCAGCGTGCCCGCCGGTGACGGCAACGACGGCGACGAAGAGCAGTGGGACCTCGTC
CTGATGCGCTCCACCGAGAACATCGGCCCCAGCGTCAGAGAAGTCGTGCATTCCAGGACCGTCGTTTATTTTCCC
GAAATAATCAGGCCCGTCATCAGCTTCTGGACCAACATCCCCCGGCCCCACGGCTCCACGGCGAACCCCAGCTCC
GTCATCGTCCTGGAAACCATCTTGCGCGCATCCTCTTTGTCGCTCTACAACCGCGCCGCCGTCCACTCCACCGGC
GTACTGTCCCAGTTCCTCCAGGTCGCCTTTGGGCAGCGCTCCTGGCTTGCCGACTCGGAGCGCGAGACACTCTTG
GCCATCTGCAAGACGCTCATGTTTCTCGGCGTAAACCAGCCGGCCGACACGCAGTTTCTGCTGTCGACGCCGGGG
CCGGGAGCCTCCGACTTCTGTCTGGACATGATGTCCGAATATGCCGGCCCGCCCTTCTTCCATTTCGATCTGTCT
CTCAGCGGTCACTCGTCCATTGAGCTGCCCAGCCTCGGCCGCGCGTTTCCCCCGCAGTCGACGGCTGGCTACACC
TTCACGGCCTGGATTCGCATCGAGTCCTTTGACCCGGCCGCCCACACCACCGTCTTCGGCGTCTTCGATGCGTCT
CAGACGTGCTTCGTGCTCATGTATCTGGAAAAGGATACCCGCAACTTCATTCTGCAAACGTCCGTCTTCTCTAGC
AAGCCGAGTGTGAGATTCAAATCCGTTGTGTTTCGTGAGAAGAAGTGGTACCACGTCGCCGTCGTCCACAGGCGG
CCCAAAACCATGACCGCCAGCAAGGCATCCCTCTACGTCAACGGGGACTTTGCCGAGCAGATCCGGTGCAGCTAT
CCTCACGTGCCGCCGCTTCTCAACGGCAGCAACGAAAGCTTTGCCTCGTTCAACCCGAGCCAGGGCAGGACCAAC
CCGGTCCAGGCCTTCCTTGGTACACCCCGTGAGCTCTCCGGCCGCACCGGGCCCGGCGTCGTCTCATCACAGTGG
TCGCTCGCCTCGGCCCATCTGTTCGAGGACGTCCTGAGTGACGATTACTTGGCCGTCCACTACGGCCTCGGCCCT
CGCTATCAGGGCAACTTCCAGGATAGCCTCGGGGGTTTTCAGACATACGAGGCGTCTGCCACTTTGGGTCTTCGC
AATGAAATCGTCCATCCCGGCAAAGACGAAGGCTCGGATATCCTGCGAGCCGTCCGCGAGAAAGCAAGCTCACTC
CTCCCGGAGTCCAAGATTCTCCTCAGCGTCATCCCTTCTGCCACCTTTCCCGAACACGTGCAGTATCTCGACACG
GGCGTGTTGCGTTCCCTGCCCCGCTCGTCTCTGCGCAGCCTTTTCCACCTGTCTAACCAGGAAGGGTCGCCGCTC
GCCGTCAACTGCACAGTCTCGAGTCTGTCGGACGCCCTCTTGCGGACCCATGGGGTCGCGTCCCTTCGTGGGAAC
CCCGTCGTTGCCGTGCCATCGCACTTGGACGAAAACCTCTGGCGCCTTGCCGGCTTCACGCCTCTGGCCCTCAAG
CTGCTGGAGCGGGCCTCTACGGCGGAAGACACCGTCCGCGCCATCGAAATCATGTTCTACTGCATCCGCAAGAGC
TGGCGCAACAGCGAGGCCATGGAGCGAGACAATGGCTACAGCATCTTGGGCATGATCCTGCGATTCAAGATCGGC
CACGGGAACTACTCGACGGGCGACCTCCCCGTCTCTCGCTTGCTGATATCCAATGAGGAGCGTGACAGTCTGACA
TTCCGCGTGCTCAGCCTGGTGCTCGGCTTTGTCGGCTACAACCACGTCGACCCCATTGAGTCGTTCATCGTCAAC
CCCCTCGCCTACCGAATTCTTCTCATCGACCTGGACATCTGGCGACGATCTGCCCAACGCACACAGGAGCTTTTC
TACAAGCAGTTTGTGACATTCGCCGTTAACAGTAAACACCACGAATTCAATAGCAGGAGGTTGATCCGAATGCGA
ATCGTTAAGAGACTCCTTGACGCTATGAAGGGCGAGGGCGTGTCGGAGGACGTTTCGGGCCACTTTATGGATGCC
TTCGGAGCTCTGGTCAAGTCGAACCTGAGCCAAGAAGTTATGAGGGCAATGTCGCTGTTCATCACGTTACTCTCG
AAGAAACAGCTTGGCATACGGGTCTTGACCATGTACTGCGGCATTCTGTGCGAGAAGGGCAACTTTAACAACATC
AAGAAGTTCGCTCGAACGGTGACCAACAAGTGGCTCCTCTACTTGCTGGCAGACGAGGACGCCGTTGTCGTCCTT
CATGGATGCAAGATTCTGTCTCGGCTCCTCGTGGCTCATGGGTCCTCGTATACCGCCAAATTCTCGGGCAAATCC
GGAGGCTTCACCATCATGGCGAACCGGCTCAAGAAGTTCTGGGATATACCCACGCTCTGGACGGTATTATTTAGC
GTCTTGTTCGGATGCGACGTCGCAGACATTGGATTTGATCGAGGCTTTGATGAGCAGAGCCTCCTCGGGCTATTT
GGCGGCCGAAAGGTCGTCTACCCCGAGTGCCTCATTACCATCACTTCCTTGCTCCAGCATGGCTTGAAGGAGGTC
ATGAGGTATCAGGAAGATCCTGACTCTCCCGCTAAGACGGACGATTTCTCCTCTGCTACTCCGAAAGCCCGGTTG
AAGCCTGAGGCTGGAGACGTGGAGCTATCCATGAACTTGGCCAAGGCGGTCGAATCCCGATCAACTTTCTCCAGA
GACCATGAACGAGTGGCCAACCATGCTTGTGTCTTGTCGACGATAGTACGATTTCTGCAAGCGCTCCAAGCACAG
TCCCCCGACTTCCGAGACTTTGCCCTGTCCTCGGAGTGGGTTCGCCTGCTCCTTCTCGCGCTTTATCCCGTCATC
GTCAGCTCAGATGCGGTCACGCCGGATGTCGAGCTGAACTCGCGAGACTCGACTCTCACCTTTGAAGGCAGCGAT
GTCATCATCAGGCCCATCGGGGGCTGCCCCGCCGCCACTCCCATTGTGCGGACGAGCAGTGTGGACGTTGTGCCA
TCGCCGCAGGCAACACCTCCCAAGGGCACGCCGCTCCGTCGAGCTTCATCTTTCGTCCTGCTCACGGCGCAGTCG
GTGTCACGCGCCGACACCCGCCCGCCGGCACCTTCTCCGCAACTGCAACCCGGCCAGAGCAGCGGCAGCGCCCTC
TCAGAGGCACTGCTCGACTTGCTGCTCAGCGTCTTCATGGACCAGGTCTTCACGCGGAAAGACTTTGCAGGCCTC
GGCCTCTTCAGCAAGGTGCCGCCTGGGTTCCAGGAACACCAGGCGTACCTCGAGTCGTACATTCTGAAAAGAGTC
GTCGCCAAGGTGTCGGACCGCGTCCATTCGAGCGGAAAGGCGATATGCGAGCCTCGCACCCTCACCAACCTGTCT
CGGCTCTGCTCGCACCTGTCCGAAGCAATATTCGAGGGCTGGTTCATTGACGGGGCAGAGGTCATGATCGACTTC
AGCGGCATGCTGCTGGAGCTGCTCCAGCGGCCCGACGTCTCGAAGCTGAAGAGCGTTCGCCTGTGCAGCCAGGCC
GTCGCCACGATCCGCAGCTGCTTCCTGAGGATCATTCTGCTGAAACTGTCGGACCTGGACAACCCCCGGATCGGA
GAGAAGGAGGCGAAGGATTTCATGAACAAGCTCGCTTACTGGCAAATGTCCATACTCGAGTGCTTCTCGTCGGAA
GACGACTACCTCAAGCTGTTTTGGTACCAGCTCTACACGAAACTCATCGACGACAAGCTGTCCATACGGATCGCC
GCGGCCAACTTCTTGCGCATCGTGCTGGTTCAGAAACCGGACGAGTCCGTGGCCGTGATCCGCTCGTGCATGGCT
CCGGACCAGCGCAAGCTATCGAGGGAGTTTCAGAAGCTGACCGAGGTTGACGACGAGACGTTCGTGGTGTGGGTG
GATCAACATCGGCCCTCTCTGGACGGGCTCTTCTTCGGCAGCATGGCCAAGACGTGGGAGGACTTTGTCAGCGTC
GAGAACCAAAGGACGTTTGAGACGGCCAGAGGGCGCCTCTCGAAGCGCAAGGAGCGGCTCAAGACGTGGAACTCG
GAAGCGGTCAGCGCGGAGAAGATACTCGTGAACCACGAGGTGGGCAACAGCGCGTGGATGAAGAGCATTTACAAC
TCGGAGCACTTCAAGTACCAGCGCCAATTGCAAGACCAACAGGACGACTTGTCGTTCCTCACGTCGGCCTATAGC
AAGATGGAGCGAGACCTCCGGAGGCCGGGTGCGGTCTTCAGCGAACCCTCCTCGCTCAAGTGGAAACTGGACCGG
ACGGAGGGGCGCAATCGGATGCGGCTGAGGCTGCTGCCAGACTCGTCGGCCGCTGAAGAAGCCTACCAGCCCAAG
AGGAAAGGGGCCGCCGCCGAGCTGCGAGGAGGCAACACGCCCGCCGCCGCCCCATCCGCGAACGGTCCGCCCGAG
GTACGGCCGCCGTCTGCCAGCCTCGACGGCAACGACGACTCATCCTCTCTCAACCCCGAGCCTGCACCGTCAACG
GATCAGACGGATTCGGGGTACGCCCCGGAAGACGACTTTGAGCTTGTTGACGACCCAAACGACCCCAACGAGGGA
GACGAGACGTTCGAAGACAAGAACCGCAAGGTCATGCGGCGACTCGAACACGGCGAGCAGGTACAGGCTGCCTAC
AACATGTCACGCATCACCGGTCTCGAGGCCTGCGAGGGCCTGCTCATCGTCGGCAAAGACGCCCTCTACATCATG
GACAACGTCTTCCAGTGCGCCAACGGGGACATTGTCAATGTGTGGCAGGCGCCGTCGGAGGAGCGCGACCCCTTC
ACCATGGTCGTCACCGGGGCCAAGACGCTGGAGCGACGCCAGAATTCCGGAGCCAGAGATCAGGAGTCGAGGCAC
TGGAGGTGGCATGACGTGATCAGTGTCTCCAAGCGCCGCTTCCTTTTCCGAGACGTCGCCATTGAGATCTTCTTC
ACCGACGGACGGAGCTATCTGCTGACGACGATCAACTCCGCCGTGCGGGACGAGCTGTTCGCCAAGATGCTCAGC
AAAGCGTCCCACACGAGCGCCCCCAACGCGCTCCCGAACCCCGAAGACGCCTGGAGGCTCGAGGCCCTGAAGGCG
TATGAGGAGTTCCCGCAGGGCTTCGGGGCGGGTCTCGGGTCCAGGCTCGGCACCCTGTTCAACGCATCCTCGTGG
AACCCGGCCATGAAGCGGTGGCAGCGGGGCGAGCTGTCCAACTTCCATTACCTGATGATGGTCAACACCATGGCC
GGCAGGACGTTCAACGACCTGACGCAATACCCCGTCTTCCCCTGGGTCCTCGCAGACTACACCAGCGAGGACCTG
GACCTGGAAGACCCGGCGACGTTCCGGGACCTCTCGAAGCCGATGGGCGCGCAGACGCCCGGGCGCGTCCCCGAC
TTCGTGGAGACGTACAACGCGCTGCGGGAGATCGGCCAGACGCCATTCCACTACGGCACTCACTACTCCTCGGCC
ATGATAGTTTCCTCGTACCTGATCCGCCTCCCGCCCTTTGTGCAGTCGTACCTGCTCGTGCAGGGCGACAGCTTT
GACCACGCGGATCGCCTGTTCCAGTCCGTCGGGGACGCGTGGAAGTCGGCCTCATGCAGGAACAAGACGGACGTG
AGGGAGCTGATCCCCGAGTTCTTTTGCTTGCCCGAATTCCTGACCAACATCAACGGCTACGACTTTGGGAACCGC
CAGAGCAACGGGGCCAAGGTCGACAGCGTGGCCCTGCCGCCCTGGGCCAAGGGCGACCCCAAGATCTTCATCGCC
AAGCACCGCGAGGCGCTCGAGAGCCCGTACGTGAGCGAGAACCTGCACCACTGGATAGACCTCGTGTTCGGCCAG
AAGCAGCGGGGCGAGGCGGCCGTCGAGAACCTCAACGTCTTCCACCACCTTTCGTACGCCGGGGCCAGCGACTTG
GACCGCATCACGGACGCCAACGAGCGGGCCATCACCGCGGGTGTCATCCACAACTTCGGCCAGACGCCTCACCAG
GTCTTCGCCAAACCGCACCCCGCCCGAGAGCATATGCGGTGCCCGATCAAGAGGCTCGACTCCGGCGTCTTCTCG
CTGAGGTGCTTGGAGCATCCGCTGCTCGAAAGCCACGACCGAGTAGCATCCCTCGTGTACGCCCCCAAGTCCGAC
CGACTCCTCTGCGCGTCCCCTCTCCGTCTCAACCTGCCGCCGTACGACAAGTTTCTGGAGTGGGGATACGCAGAC
GGCAGTATTCGCTTCTTCTTCAGCGACAATCGCAAGCCGGCTGGTCTGTTCGAGAATCTTCACATCGGCCAGATC
TCGTGCGCCTGCTTTGCCGATTCCAAGACGCTGATCACGGCGGGCGAGGACTGCGTGGTATCCGTGTACTCGGTG
CGCACGGCGCCGGGGAAACAGGTCGACCTGTTGCCCAGGTCCAGCGTCTTTGGGCACAAGACGCCGGTGACGGCC
ATGGCAGTCAGCAAGGCATTCAGCACCTTCGTGACGGCGTCGTCGGACGGGCAGGCGTTTCTGTGGGACCTCAAC
CAGCTGTCGTTCATACGGAAGCTGCCCCTGGTCCGGCAGGCCGAGTGCGCGTGCATCAACGACGTGTCGGGGGAG
ATCCTGCTGTGCTCGGGGCCGAACGTGCTGCTGTACACGCTCAACGGCTCGCTGATACTGGACCAGAACGTGTGC
ACGGAGCAGGACGACTACGTCCATTCGTGCGCCTTCTACGAGGGTGCCGGGGACGAGTGGCTGGAGAACCAGCTC
ATCTTCACCGGGCACAGCCGCGGCCGTGTCAACATCTGGCGCAAGGGCATCGCGGCGGGCAAGTGGACGCTGGAA
CTGCTGCGCCGGCTGGACCATGCCGACGGCAAGAGCGACGAGGGGGAGAACACGGAGGCCGGCATCACGTGCATC
ACGCCGATGCCGACATGCGTGTACACCGGGGACGACGAGGGCCGCGTGTACGAGTGGAACTTGGGACGAGGGGAC
AGATAG
Gene >Hirsu2|4329
ATGGCCTCTCACCCTCGACGGTACCGCTCCTCGACCTCGGCCTCGGCCCAGCCGTCGTCCAAGTCGTTCCAAGTC
CTGCGCGCCTTGCTCGACGACCTCGCCGACGATGCCGCCTCGCCCGGCACCAACGGATACCCCCCGGTGGGCACG
CTGTGCAGGAGCCTGACCAAGATTTCTCAACATGTCGCCTCTGCGCCTCAGCCCGCCGTCCAGGACGACTTCCGC
CACGCCGACGGCTTCCAAGCCCTCCTCGACCTTCTGCACTGCTTTTCCGGCTACTACGACCCGCACAAACGAACC
GAAACTGAAATGCTTGCCCTCTTCAGGCTGCTGGGAGCCTGCCTCGGCGTCCTGTCGGCCGCGCTGAGGCGCCAC
TCGGGCAACAAGCGCTTCTTCCGCTACCGAGTCCAGGACGGCGGCTGGGAGACGCTCGAGCAGGTGCTCGCGAGC
ATCGGGCTGGGTGGCGCCGAGCTCGACCCCTGGGTGAGCTGCCACGTCTTCGGCAAATTGCTGTCCTTTGCCCTC
GACGACGACGGCCTGGACCTGCTCTGCCAGTCCATTGCCAAAGCGCTGCGCCCGGAGGCTGCCGCCAGCTCGGGC
AGCTGCGCCGGCCGAGAGGGCAGCGTGCCCGCCGGTGACGGCAACGACGGCGACGAAGAGCAGTGGGACCTCGTC
CTGATGCGCTCCACCGAGAACATCGGCCCCAGCGTCAGAGAAGTCGTGCATTCCAGGACCGTCGTTTATTTTCCC
GAAATAATCAGGCCCGTCATCAGCTTCTGGACCAACATCCCCCGGCCCCACGGCTCCACGGCGAACCCCAGCTCC
GTCATCGTCCTGGAAACCATCTTGCGCGCATCCTCTTTGTCGCTCTACAACCGCGCCGCCGTCCACTCCACCGGC
GTACTGTCCCAGTTCCTCCAGGTCGCCTTTGGGCAGCGCTCCTGGCTTGCCGACTCGGAGCGCGAGACACTCTTG
GCCATCTGCAAGACGCTCATGTTTCTCGGCGTAAACCAGCCGGCCGACACGCAGTTTCTGCTGTCGACGCCGGGG
CCGGGAGCCTCCGACTTCTGTCTGGACATGATGTCCGAATATGCCGGCCCGCCCTTCTTCCATTTCGATCTGTCT
CTCAGCGGTCACTCGTCCATTGAGCTGCCCAGCCTCGGCCGCGCGTTTCCCCCGCAGTCGACGGCTGGCTACACC
TTCACGGCCTGGATTCGCATCGAGTCCTTTGACCCGGCCGCCCACACCACCGTCTTCGGCGTCTTCGATGCGTCT
CAGACGTGCTTCGTGCTCATGTATCTGGAAAAGGATACCCGCAACTTCATTCTGCAAACGTCCGTCTTCTCTAGC
AAGCCGAGTGTGAGATTCAAATCCGTTGTGTTTCGTGAGAAGAAGTGGTACCACGTCGCCGTCGTCCACAGGCGG
CCCAAAACCATGACCGCCAGCAAGGCATCCCTCTACGTCAACGGGGACTTTGCCGAGCAGATCCGGTGCAGCTAT
CCTCACGTGCCGCCGCTTCTCAACGGCAGCAACGAAAGCTTTGCCTCGTTCAACCCGAGCCAGGGCAGGACCAAC
CCGGTCCAGGCCTTCCTTGGTACACCCCGTGAGCTCTCCGGCCGCACCGGGCCCGGCGTCGTCTCATCACAGTGG
TCGCTCGCCTCGGCCCATCTGTTCGAGGACGTCCTGAGTGACGATTACTTGGCCGTCCACTACGGCCTCGGCCCT
CGCTATCAGGGCAACTTCCAGGATAGCCTCGGGGGTTTTCAGACATACGAGGCGTCTGCCACTTTGGGTCTTCGC
AATGAAATCGTCCATCCCGGCAAAGACGAAGGCTCGGATATCCTGCGAGCCGTCCGCGAGAAAGCAAGCTCACTC
CTCCCGGAGTCCAAGATTCTCCTCAGCGTCATCCCTTCTGCCACCTTTCCCGAACACGTGCAGTATCTCGACACG
GGCGTGTTGCGTTCCCTGCCCCGCTCGTCTCTGCGCAGCCTTTTCCACCTGTCTAACCAGGAAGGGTCGCCGCTC
GCCGTCAACTGCACAGTCTCGAGTCTGTCGGACGCCCTCTTGCGGACCCATGGGGTCGCGTCCCTTCGTGGGAAC
CCCGTCGTTGCCGTGCCATCGCACTTGGACGAAAACCTCTGGCGCCTTGCCGGCTTCACGCCTCTGGCCCTCAAG
CTGCTGGAGCGGGCCTCTACGGCGGAAGACACCGTCCGCGCCATCGAAATCATGTTCTACTGCATCCGCAAGAGC
TGGCGCAACAGCGAGGCCATGGAGCGAGACAATGGCTACAGCATCTTGGGCATGATCCTGCGATTCAAGATCGGC
CACGGGAACTACTCGACGGGCGACCTCCCCGTCTCTCGCTTGCTGATATCCAATGAGGAGCGTGACAGTCTGACA
TTCCGCGTGCTCAGCCTGGTGCTCGGCTTTGTCGGCTACAACCACGTCGACCCCATTGAGTCGTTCATCGTCAAC
CCCCTCGCCTACCGAATTCTTCTCATCGACCTGGACATCTGGCGACGATCTGCCCAACGCACACAGGAGCTTTTC
TACAAGCAGTTTGTGACATTCGCCGTTAACAGTAAACACCACGAATTCAATAGCAGGAGGTTGATCCGAATGCGT
AGGTTGCGGGGCTTCGCGTCAACTTACGGGGCACATCATTCACTGACTCGGCCCTGCAGGAATCGTTAAGAGACT
CCTTGACGCTATGAAGGGCGAGGGCGTGTCGGAGGACGTTTCGGGCCACTTTATGGATGCCTTCGGAGCTCTGGT
CAAGTCGAACCTGAGCCAAGAAGTTATGAGGGCAATGTCGCTGTTCATCACGTATGCCTTCCACACTTCGCCTCT
GTCGACATCGCGAACGCCCAAACCCCTTTCCTCGGCCACCTCTCGCTCAAGCGTTCCTAGTCCCTCGAAAAGGGT
GTCCGGGGAAGCCAGCAGGGCGCACAGCCCCCCATACGGGGGCAGGTTACTCTCGAAGAAACAGCTTGGCATACG
GGTCTTGACCATGTACTGCGGCATTCTGTGCGAGAAGGGCAACTTTAACAACATCAAGAAGTTCGCTCGAACGGT
GACCAACAAGGTGAGTGCAGACCTGCTCCAACGTTGGACTGTGGCTTCGGATACTAAACTGGATAGTGGCTCCTC
TACTTGCTGGCAGACGAGGACGCCGTTGTCGTCCTTCATGGATGCAAGATTCTGTCTCGGCTCCTCGTGGCTCAT
GGGTCCTCGTATACCGCCAAATTCTCGGGCAAATCCGGAGGCTTCACCATCATGGCGAACCGGCTCAAGAAGTTC
TGGGATATACCCACGCTCTGGACGGTATTATTTAGCGTCTTGTTCGGATGCGACGTCGCAGACATTGGATTTGAT
CGAGGCTTTGATGAGCAGAGCCTCCTCGGGCTATTTGGCGGCCGAAAGGTCGTCTACCCCGAGTGCCTCATTACC
ATCACTTCCTTGCTCCAGCATGGCTTGAAGGAGGTCATGAGGTATCAGGAAGATCCTGACTCTCCCGCTAAGACG
GACGATTTCTCCTCTGCTACTCCGAAAGCCCGGTTGAAGCCTGAGGCTGGAGACGTGGAGCTATCCATGAACTTG
GCCAAGGCGGTCGAATCCCGATGTGGGTACACACACATCCACGGTTCCTGGTCTGGGCGACATCACTGACCTGGG
TCGCAGCAACTTTCTCCAGAGACCATGAACGAGTGGCCAACCATGCTTGTGTCTTGTCGACGATAGTACGATTTC
TGCAAGCGCTCCAAGCACAGTCCCCCGACTTCCGAGACTTTGCCCTGTCCTCGGAGTGGGTTCGCCTGCTCCTTC
TCGCGCTTTATCCCGTCATCGTCAGCTCAGATGCGGTCACGCCGGATGTCGAGCTGAACTCGCGAGACTCGACTC
TCACCTTTGAAGGCAGCGATGTCATCATCAGGCCCATCGGGGGCTGCCCCGCCGCCACTCCCATTGTGCGGACGA
GCAGTGTGGACGTTGTGCCATCGCCGCAGGCAACACCTCCCAAGGGCACGCCGCTCCGTCGAGCTTCATCTTTCG
TCCTGCTCACGGCGCAGTCGGTGTCACGCGCCGACACCCGCCCGCCGGCACCTTCTCCGCAACTGCAACCCGGCC
AGAGCAGCGGCAGCGCCCTCTCAGAGGCACTGCTCGACTTGCTGCTCAGCGTCTTCATGGACCAGGTCTTCACGC
GGAAAGACTTTGCAGGCCTCGGCCTCTTCAGCAAGGTGCCGCCTGGGTTCCAGGAACACCAGGCGTACCTCGAGT
CGTACATTCTGAAAAGAGTCGTCGCCAAGGTGTCGGACCGCGTCCATTCGAGCGGAAAGGCGATATGCGAGCCTC
GCACCCTCACCAACCTGTCTCGGCTCTGCTCGCACCTGTCCGAAGCAATATTCGAGGGCTGGTTCATTGACGGGG
CAGAGGTCATGATCGACTTCAGCGGCATGCTGCTGGAGCTGCTCCAGCGGCCCGACGTCTCGAAGCTGAAGAGCG
TTCGCCTGTGCAGCCAGGCCGTCGCCACGATCCGCAGCTGCTTCCTGAGGATCATTCTGCTGAAACTGTCGGACC
TGGACAACCCCCGGATCGGAGAGAAGGAGGCGAAGGATTTCATGAACAAGCTCGCTTACTGGCAAATGTCCATAC
TCGAGTGCTTCTCGTCGGAAGACGACTACCTCAAGCTGTTTTGGTACCAGCTCTACACGAAACTCATCGACGACA
AGCTGTCCATACGGATCGCCGCGGCCAACTTCTTGCGCATCGTGCTGGTTCAGAAACCGGACGAGTCCGTGGCCG
TGATCCGCTCGTGCATGGCTCCGGACCAGCGCAAGCTATCGAGGGAGTTTCAGAAGCTGACCGAGGTTGACGACG
AGACGTTCGTGGTGTGGGTGGATCAACATCGGCCCTCTCTGGACGGGCTCTTCTTCGGCAGCATGGCCAAGACGT
GGGAGGACTTTGTCAGCGTCGAGAACCAAAGGACGTTTGAGACGGCCAGAGGGCGCCTCTCGAAGCGCAAGGAGC
GGCTCAAGACGTGGAACTCGGAAGCGGTCAGCGCGGAGAAGATACTCGTGAACCACGAGGTGGGCAACAGCGCGT
GGATGAAGAGCATTTACAACTCGGAGCACTTCAAGTACCAGCGCCAATTGCAAGACCAACAGGACGACTTGTCGT
TCCTCACGTCGGCCTATAGCAAGATGGAGCGAGACCTCCGGAGGCCGGGTGCGGTCTTCAGCGAACCCTCCTCGC
TCAAGTGGAAACTGGACCGGACGGAGGGGCGCAATCGGATGCGGCTGAGGCTGCTGCCAGACTCGTCGGCCGCTG
AAGAAGCCTACCAGCCCAAGAGGAAAGGGGCCGCCGCCGAGCTGCGAGGAGGCAACACGCCCGCCGCCGCCCCAT
CCGCGAACGGTCCGCCCGAGGTACGGCCGCCGTCTGCCAGCCTCGACGGCAACGACGACTCATCCTCTCTCAACC
CCGAGCCTGCACCGTCAACGGATCAGACGGATTCGGGGTACGCCCCGGAAGACGACTTTGAGCTTGTTGACGACC
CAAACGACCCCAACGAGGGAGACGAGACGTTCGAAGACAAGAACCGCAAGGTCATGCGGCGACTCGAACACGGCG
AGCAGGTACAGGCTGCCTACAACATGTCACGCATCACCGGTCTCGAGGCCTGCGAGGGCCTGCTCATCGTCGGCA
AAGACGCCCTCTACATCATGGACAACGTCTTCCAGTGCGCCAACGGGGACATTGTCAATGTGTGGCAGGCGCCGT
CGGAGGAGCGCGACCCCTTCACCATGGTCGTCACCGGGGCCAAGACGCTGGAGCGACGCCAGAATTCCGGAGCCA
GAGATCAGGAGTCGAGGCACTGGAGGTGGCATGACGTGATCAGTGTCTCCAAGCGCCGCTTCCTTTTCCGAGACG
TCGCCATTGAGATCTTCTTCACCGACGGACGGAGCTATCTGCTGACGACGATCAACTCCGCCGTGCGGGACGAGC
TGTTCGCCAAGATGCTCAGCAAAGCGTCCCACACGAGCGCCCCCAACGCGCTCCCGAACCCCGAAGACGCCTGGA
GGCTCGAGGCCCTGAAGGCGTATGAGGAGTTCCCGCAGGGCTTCGGGGCGGGTCTCGGGTCCAGGCTCGGCACCC
TGTTCAACGCATCCTCGTGGAACCCGGCCATGAAGCGGTGGCAGCGGGGCGAGCTGTCCAACTTCCATTACCTGA
TGATGGTCAACACCATGGCCGGCAGGACGTTCAACGACCTGACGCAATACCCCGTCTTCCCCTGGGTCCTCGCAG
ACTACACCAGCGAGGACCTGGACCTGGAAGACCCGGCGACGTTCCGGGACCTCTCGAAGCCGATGGGCGCGCAGA
CGCCCGGGCGCGTCCCCGACTTCGTGGAGACGTACAACGCGCTGCGGGAGATCGGCCAGACGCCATTCCACTACG
GCACTCACTACTCCTCGGCCATGATAGTTTCCTCGTACCTGATCCGCCTCCCGCCCTTTGTGCAGTCGTACCTGC
TCGTGCAGGGCGACAGCTTTGACCACGCGGATCGCCTGTTCCAGTCCGTCGGGGACGCGTGGAAGTCGGCCTCAT
GCAGGAACAAGACGGACGTGAGGGAGCTGATCCCCGAGTTCTTTTGCTTGCCCGAATTCCTGACCAACATCAACG
GCTACGACTTTGGGAACCGCCAGAGCAACGGGGCCAAGGTCGACAGCGTGGCCCTGCCGCCCTGGGCCAAGGGCG
ACCCCAAGATCTTCATCGCCAAGCACCGCGAGGCGCTCGAGAGCCCGTACGTGAGCGAGAACCTGCACCACTGGA
TAGACCTCGTGTTCGGCCAGAAGCAGCGGGGCGAGGCGGCCGTCGAGAACCTCAACGTCTTCCACCACCTTTCGT
ACGCCGGGGCCAGCGACTTGGACCGCATCACGGACGCCAACGAGCGGGCCATCACCGCGGGTGTCATCCACAACT
TCGGCCAGACGCCTCACCAGGTCTTCGCCAAACCGCACCCCGCCCGAGAGCATATGCGGTGCCCGATCAAGAGGC
TCGACTCCGGCGTCTTCTCGCTGAGGTGCTTGGAGCATCCGCTGCTCGGTGAGCAGCCACCGGCCGCGATCCGAT
CCCCGAGGATCGTCGGGGAGGCTTGCTGACACTCGAGACAGAAAGCCACGACCGAGTAGCATCCCTCGTGTACGC
CCCCAAGTCCGACCGACTCCTCTGCGCGTCCCCTCTCCGTCTCAACCTGCCGCCGTACGACAAGTTTCTGGAGTG
GGGATACGCAGACGGCAGTATTCGCTTCTTCTTCAGCGACAATCGCAAGGTGACTTTTGGACACGCCCCCACCCT
CCCACCTCCTGCAATGCCGATGCACCCGTGCCTATGAACTTGGCGGGCTGACGAGAAAGAAGCCGGCTGGTCTGT
TCGAGAATCTTCACATCGGCCAGATCTCGTGCGCCTGCTTTGCCGATTCCAAGACGCTGATCACGGCGGGCGAGG
ACTGCGTGGTATCCGTGTACTCGGTGCGCACGGCGCCGGGGAAACAGGTCGACCTGTTGCCCAGGTCCAGCGTCT
TTGGGCACAAGACGCCGGTGACGGCCATGGCAGTCAGCAAGGCATTCAGCACCTTCGTGACGGCGTCGTCGGACG
GGCAGGCGTTTCTGTGGGACCTCAACCAGCTGTCGTTCATACGGAAGCTGCCCCTGGTCCGGCAGGCCGAGTGCG
CGTGCATCAACGACGTGTCGGGGGAGATCCTGCTGTGCTCGGGGCCGAACGTGCTGCTGTACACGCTCAACGGCT
CGCTGATACTGGACCAGAACGTGTGCACGGAGCAGGACGACTACGTCCATTCGTGCGCCTTCTACGAGGGTGCCG
GGGACGAGTGGCTGGAGAACCAGCTCATCTTCACCGGGCACAGCCGCGGCCGTGTCAACATCTGGCGCAAGGGCA
TCGCGGCGGGCAAGTGGACGCTGGAACTGCTGCGCCGGCTGGACCATGCCGACGGCAAGAGCGACGAGGGGGAGA
ACACGGAGGCCGGCATCACGTGCATCACGCCGATGCCGACATGCGTGTACACCGGGGACGACGAGGGCCGCGTGG
TAAGTCAAGTCGTACAAGCGCAACTGGCGTGGCACGGCGCCGGAAGAGCAGAGCTGACGGGGAAGCAGTACGAGT
GGAACTTGGGACGAGGGGACAGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail