Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4323
Gene name
LocationContig_2207:2984..3281
Strand+
Gene length (bp)297
Transcript length (bp)297
Coding sequence length (bp)297
Protein length (aa) 99

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6367 0.787 0.0337 0.0638 0.1469 0.022 0.1197 0.2189 0.083 0.0394

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6554
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2216
Ophiocordyceps subramaniannii Hirsu2|301
Ophiocordyceps subramaniannii Hirsu2|4323 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8922

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4323
MDHLVFGTNGFTGDSQPADIPDNTEPPHLVCDTSTVPSSSPSTANLGPSQPALNPEAPCFDFAVSTGTDDGLLPS
GYILPLNHKSFQYGMTANDEIKW*
Coding >Hirsu2|4323
ATGGATCACCTAGTATTTGGCACCAACGGCTTTACGGGAGATTCCCAACCAGCCGATATTCCCGACAATACTGAA
CCTCCTCACTTGGTTTGTGACACCTCCACTGTTCCATCAAGCTCACCATCCACAGCTAACTTGGGTCCTAGCCAG
CCGGCTCTGAACCCTGAAGCCCCTTGTTTCGACTTTGCAGTCTCTACTGGTACAGACGATGGGCTACTGCCTAGT
GGATATATTCTACCACTTAATCACAAGTCTTTCCAGTACGGAATGACGGCAAACGATGAGATAAAATGGTAA
Transcript >Hirsu2|4323
ATGGATCACCTAGTATTTGGCACCAACGGCTTTACGGGAGATTCCCAACCAGCCGATATTCCCGACAATACTGAA
CCTCCTCACTTGGTTTGTGACACCTCCACTGTTCCATCAAGCTCACCATCCACAGCTAACTTGGGTCCTAGCCAG
CCGGCTCTGAACCCTGAAGCCCCTTGTTTCGACTTTGCAGTCTCTACTGGTACAGACGATGGGCTACTGCCTAGT
GGATATATTCTACCACTTAATCACAAGTCTTTCCAGTACGGAATGACGGCAAACGATGAGATAAAATGGTAA
Gene >Hirsu2|4323
ATGGATCACCTAGTATTTGGCACCAACGGCTTTACGGGAGATTCCCAACCAGCCGATATTCCCGACAATACTGAA
CCTCCTCACTTGGTTTGTGACACCTCCACTGTTCCATCAAGCTCACCATCCACAGCTAACTTGGGTCCTAGCCAG
CCGGCTCTGAACCCTGAAGCCCCTTGTTTCGACTTTGCAGTCTCTACTGGTACAGACGATGGGCTACTGCCTAGT
GGATATATTCTACCACTTAATCACAAGTCTTTCCAGTACGGAATGACGGCAAACGATGAGATAAAATGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail