Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4321
Gene name
LocationContig_2206:1473..3256
Strand+
Gene length (bp)1783
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05183 RdRP RNA dependent RNA polymerase 5.3E-25 449 537

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 442 537 1.0E-14
sp|O82504|RDR2_ARATH RNA-dependent RNA polymerase 2 OS=Arabidopsis thaliana GN=RDR2 PE=1 SV=1 446 537 3.0E-12
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 444 537 6.0E-11
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 452 537 3.0E-10
sp|Q9SG02|RDR6_ARATH RNA-dependent RNA polymerase 6 OS=Arabidopsis thaliana GN=RDR6 PE=1 SV=1 448 537 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 442 537 1.0E-14
sp|O82504|RDR2_ARATH RNA-dependent RNA polymerase 2 OS=Arabidopsis thaliana GN=RDR2 PE=1 SV=1 446 537 3.0E-12
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 444 537 6.0E-11
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 452 537 3.0E-10
sp|Q9SG02|RDR6_ARATH RNA-dependent RNA polymerase 6 OS=Arabidopsis thaliana GN=RDR6 PE=1 SV=1 448 537 2.0E-09
sp|Q7XM31|RDR2_ORYSJ Probable RNA-dependent RNA polymerase 2 OS=Oryza sativa subsp. japonica GN=RDR2 PE=2 SV=1 444 537 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003968 RNA-directed 5'-3' RNA polymerase activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0034062 5'-3' RNA polymerase activity No
GO:0097747 RNA polymerase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4321
MDVFLRNVPLDLAEGSLRKELKPVMNVLGVVDWDCSKSRRKNFAFVSFLQLADGERFLAKHGAVAAAAAPPPDPS
SAAATFKSLPFLGARPRQLARLHILSLPVYASRSRRPIDRQTLSALERDHDVRQQQQQQQQQQRGAGAASVRCPL
LDVACGKMVFAGPSGADLVFAHQTGLRARAQLRFGRRNLSAVFDDDGDRMDVPYDILVDLVADHATKALTLVLSE
PPRFYARLPEPPDPRRGGHVRWERVAALPRWADHDRYVAHCLVYQLWLGPAHDEAVRSLRQLDLVAVSRHRVLLE
PRPEPFVHDYGTAVGRFNGRIQSPDVNRLVPFALLFQVQLLVWNNYLHPSGALAVLDVLERAAKTTEATAATATA
AKRDFPFKADSMKLLLPKIPYPVPGTEPASLDPTRLMETAARLEMERYREDLHRRGVYGPPLPGHQTWVFKAMVT
PTRILLQGPDAESKNRVLRMFPDHGDHFLRVSFCDEDGQDLPFNPKVSNEAALERYRRVLRDGIHIAGRRFSFLG
FSHSSLRSHSTWPSPRRPTPSTWSAAGS*
Coding >Hirsu2|4321
ATGGACGTCTTCCTGCGCAATGTCCCCCTCGACCTGGCCGAGGGCAGCCTCCGCAAGGAGCTCAAGCCGGTGATG
AACGTGCTAGGCGTCGTCGACTGGGACTGCTCCAAGAGCCGGCGCAAGAACTTCGCCTTCGTCTCCTTCCTCCAG
CTGGCCGACGGCGAACGGTTCCTGGCCAAGCACGGGGCCGTGGCGGCGGCGGCGGCGCCCCCGCCCGACCCGTCC
TCCGCCGCCGCCACCTTCAAGAGCCTGCCGTTCCTCGGCGCCCGGCCGCGGCAGCTGGCCCGGCTGCACATCCTG
TCGCTGCCCGTCTACGCCAGCCGCAGCCGGCGGCCCATCGACCGCCAGACGCTCAGCGCGCTCGAGCGCGACCAC
GACGTGCGCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGCGGCGCCGGCGCCGCCTCCGTCCGCTGCCCCCTC
CTCGACGTGGCCTGCGGCAAGATGGTCTTCGCCGGCCCGTCCGGCGCCGACCTCGTCTTCGCCCACCAGACCGGC
CTCCGGGCCCGGGCCCAGCTGCGGTTCGGCCGGCGCAACCTGTCGGCCGTCTTCGACGACGACGGCGACCGCATG
GACGTGCCGTACGACATCCTCGTCGACCTCGTCGCCGACCACGCCACCAAGGCCCTGACGCTGGTCCTGAGCGAG
CCGCCGCGCTTCTACGCCCGCCTGCCGGAGCCGCCGGACCCGCGCCGCGGCGGCCACGTCCGGTGGGAGCGCGTC
GCCGCCCTGCCGCGCTGGGCCGACCACGACCGCTACGTCGCCCACTGCCTCGTCTACCAGCTGTGGCTCGGCCCG
GCCCACGACGAGGCCGTCCGCAGCCTGCGCCAGCTGGACCTCGTCGCCGTCAGCCGGCACCGCGTCCTGCTGGAG
CCGCGGCCGGAGCCGTTCGTGCACGACTACGGCACCGCCGTCGGCCGCTTCAACGGCCGGATCCAGAGCCCGGAC
GTCAACCGGCTCGTGCCCTTCGCCCTGCTCTTCCAGGTCCAGCTGCTGGTGTGGAACAACTACCTGCACCCGTCG
GGCGCGCTGGCCGTGCTCGACGTGCTCGAGCGGGCGGCCAAGACGACGGAGGCGACGGCGGCGACGGCGACGGCC
GCCAAGCGCGACTTCCCCTTCAAGGCCGACTCGATGAAGCTGCTGCTGCCCAAGATCCCGTACCCGGTCCCCGGC
ACGGAGCCGGCCAGCCTGGACCCGACGCGCCTGATGGAGACGGCCGCCCGGCTGGAGATGGAGCGGTACCGCGAG
GACCTGCACCGGCGCGGCGTCTACGGGCCGCCGCTGCCGGGCCACCAGACCTGGGTCTTCAAGGCCATGGTGACG
CCGACGCGGATCCTGCTGCAGGGCCCGGACGCCGAGAGCAAGAACCGGGTGCTGCGCATGTTCCCCGACCACGGC
GACCACTTCCTGCGCGTCTCCTTCTGCGACGAGGACGGCCAGGACCTGCCCTTCAACCCAAAGGTCTCCAACGAG
GCGGCCCTGGAGCGGTACCGGCGCGTGCTGCGCGACGGCATCCACATCGCCGGCCGGCGCTTCTCCTTCCTCGGC
TTCTCGCACTCGTCGCTGCGCTCGCACTCGACCTGGCCTTCTCCGAGACGCCCTACGCCGTCGACCTGGTCCGCA
GCCGGATCCTGA
Transcript >Hirsu2|4321
ATGGACGTCTTCCTGCGCAATGTCCCCCTCGACCTGGCCGAGGGCAGCCTCCGCAAGGAGCTCAAGCCGGTGATG
AACGTGCTAGGCGTCGTCGACTGGGACTGCTCCAAGAGCCGGCGCAAGAACTTCGCCTTCGTCTCCTTCCTCCAG
CTGGCCGACGGCGAACGGTTCCTGGCCAAGCACGGGGCCGTGGCGGCGGCGGCGGCGCCCCCGCCCGACCCGTCC
TCCGCCGCCGCCACCTTCAAGAGCCTGCCGTTCCTCGGCGCCCGGCCGCGGCAGCTGGCCCGGCTGCACATCCTG
TCGCTGCCCGTCTACGCCAGCCGCAGCCGGCGGCCCATCGACCGCCAGACGCTCAGCGCGCTCGAGCGCGACCAC
GACGTGCGCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGCGGCGCCGGCGCCGCCTCCGTCCGCTGCCCCCTC
CTCGACGTGGCCTGCGGCAAGATGGTCTTCGCCGGCCCGTCCGGCGCCGACCTCGTCTTCGCCCACCAGACCGGC
CTCCGGGCCCGGGCCCAGCTGCGGTTCGGCCGGCGCAACCTGTCGGCCGTCTTCGACGACGACGGCGACCGCATG
GACGTGCCGTACGACATCCTCGTCGACCTCGTCGCCGACCACGCCACCAAGGCCCTGACGCTGGTCCTGAGCGAG
CCGCCGCGCTTCTACGCCCGCCTGCCGGAGCCGCCGGACCCGCGCCGCGGCGGCCACGTCCGGTGGGAGCGCGTC
GCCGCCCTGCCGCGCTGGGCCGACCACGACCGCTACGTCGCCCACTGCCTCGTCTACCAGCTGTGGCTCGGCCCG
GCCCACGACGAGGCCGTCCGCAGCCTGCGCCAGCTGGACCTCGTCGCCGTCAGCCGGCACCGCGTCCTGCTGGAG
CCGCGGCCGGAGCCGTTCGTGCACGACTACGGCACCGCCGTCGGCCGCTTCAACGGCCGGATCCAGAGCCCGGAC
GTCAACCGGCTCGTGCCCTTCGCCCTGCTCTTCCAGGTCCAGCTGCTGGTGTGGAACAACTACCTGCACCCGTCG
GGCGCGCTGGCCGTGCTCGACGTGCTCGAGCGGGCGGCCAAGACGACGGAGGCGACGGCGGCGACGGCGACGGCC
GCCAAGCGCGACTTCCCCTTCAAGGCCGACTCGATGAAGCTGCTGCTGCCCAAGATCCCGTACCCGGTCCCCGGC
ACGGAGCCGGCCAGCCTGGACCCGACGCGCCTGATGGAGACGGCCGCCCGGCTGGAGATGGAGCGGTACCGCGAG
GACCTGCACCGGCGCGGCGTCTACGGGCCGCCGCTGCCGGGCCACCAGACCTGGGTCTTCAAGGCCATGGTGACG
CCGACGCGGATCCTGCTGCAGGGCCCGGACGCCGAGAGCAAGAACCGGGTGCTGCGCATGTTCCCCGACCACGGC
GACCACTTCCTGCGCGTCTCCTTCTGCGACGAGGACGGCCAGGACCTGCCCTTCAACCCAAAGGTCTCCAACGAG
GCGGCCCTGGAGCGGTACCGGCGCGTGCTGCGCGACGGCATCCACATCGCCGGCCGGCGCTTCTCCTTCCTCGGC
TTCTCGCACTCGTCGCTGCGCTCGCACTCGACCTGGCCTTCTCCGAGACGCCCTACGCCGTCGACCTGGTCCGCA
GCCGGATCCTGA
Gene >Hirsu2|4321
ATGGACGTCTTCCTGCGCAATGTCCCCCTCGACCTGGCCGAGGGCAGCCTCCGCAAGGAGCTCAAGCCGGTGATG
AACGTGCTAGGCGTCGTCGACTGGGACTGCTCCAAGAGCCGGCGCAAGAACTTCGCCTTCGTCTCCTTCCTCCAG
CTGGCCGACGGCGAACGGTTCCTGGCCAAGCACGGGGCCGTGGCGGCGGCGGCGGCGCCCCCGCCCGACCCGTCC
TCCGCCGCCGCCACCTTCAAGAGCCTGCCGTTCCTCGGCGCCCGGCCGCGGCAGCTGGCCCGGCTGCACATCCTG
TCGCTGCCCGTCTACGCCAGCCGCAGCCGGCGGCCCATCGACCGCCAGACGCTCAGCGCGCTCGAGCGCGACCAC
GACGTGCGCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGCGGCGCCGGCGCCGCCTCCGTCCGCTGCCCCCTC
CTCGACGTGGCCTGCGGCAAGATGGTCTTCGCCGGCCCGTCCGGCGCCGACCTCGTCTTCGCCCACCAGACCGGC
CTCCGGGCCCGGGCCCAGCTGCGGTTCGGCCGGCGCAACCTGTCGGCCGTCTTCGACGACGACGGCGACCGCATG
GACGTGCCGTACGACATCCTCGTCGACCTCGTCGCCGACCACGCCACCAAGGCCCTGACGCTGGTCCTGAGCGAG
CCGCCGCGCTTCTACGCCCGCCTGCCGGAGCCGCCGGACCCGCGCCGCGGCGGCCACGTCCGGTGGGAGCGCGTC
GCCGCCCTGCCGCGCTGGGCCGACCACGACCGCTACGTCGCCCACTGCCTCGTCTACCAGCTGTGGCTCGGCCCG
GCCCACGACGAGGCCGTCCGCAGCCTGCGCCAGCTGGACCTCGTCGCCGTCAGCCGGCACCGCGTCCTGCTGGAG
CCGCGGCCGGAGCCGTTCGTGCACGACTACGGCACCGCCGTCGGCCGCTTCAACGGCCGGATCCAGAGCCCGGAC
GTCAACCGGCTCGTGCCCTTCGCCCTGCTCTTCCAGGTCCAGCTGCTGGTGTGGAACAACTACCTGCACCCGTCG
GGCGCGCTGGCCGTGCTCGACGTGCTCGAGCGGGCGGCCAAGACGACGGAGGCGACGGCGGCGACGGCGACGGCC
GCCAAGCGCGACTTCCCCTTCAAGGCCGACTCGATGAAGCTGCTGCTGCCCAAGATCCCGTACCCGGTCCCCGGC
ACGGAGCCGGCCAGCCTGGACCCGACGCGCCTGATGGAGACGGCCGCCCGGCTGGAGATGGAGCGGTACCGCGAG
GACCTGCACCGGCGCGGCGTCTACGGGCCGCCGCTGCCGGGCCACCAGACCTGGGTCTTCAAGGCCATGGTGACG
CCGACGCGGATCCTGCTGCAGGGCCCGGACGCCGAGAGCAAGAACCGGGTGCTGCGCATGTTCCCCGACCACGGC
GACCACTTCCTGCGCGTCTCCTTCTGCGACGAGGACGGCCAGGACCTGCCCTTCAACCCAAAGGTCTCCAACGAG
GCGGCCCTGGAGCGGTACCGGCGCGTGCTGCGCGACGGCATCCACATCGCCGGCCGGCGCTTCTCCTTCCTCGGC
TTCTCGCACTCGTCGCTGCGCTCGCACTCGACCTGGTTCCTGGCGCCCTTCGTCGACGGCGACATGCGGCGCCAC
GACTACGACAGCATCCTGCGCTCGCTCGGCGACTTCAGCGAGATCCGCAGCGCCGCCCGGTGCGCGGCCCGCATC
GGCCAGGCCTTCTCCGAGACGCCCTACGCCGTCGACCTGGTCCGCAGCCGGATCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail