Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|432
Gene name
LocationContig_1087:7197..8809
Strand+
Gene length (bp)1612
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03849 Tfb2 Transcription factor Tfb2 7.3E-135 13 402
PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain 1.6E-20 422 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q75B51|TFB2_ASHGO RNA polymerase II transcription factor B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB2 PE=3 SV=1 10 489 2.0E-118
sp|Q6BZX4|TFB2_YARLI RNA polymerase II transcription factor B subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB2 PE=3 SV=1 10 491 7.0E-118
sp|P87303|TFB2_SCHPO RNA polymerase II transcription factor B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb2 PE=1 SV=2 10 489 6.0E-114
sp|Q6CLR2|TFB2_KLULA RNA polymerase II transcription factor B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB2 PE=3 SV=1 1 485 3.0E-113
sp|Q6BGW8|TFB2_DEBHA RNA polymerase II transcription factor B subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB2 PE=3 SV=2 1 485 1.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q75B51|TFB2_ASHGO RNA polymerase II transcription factor B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB2 PE=3 SV=1 10 489 2.0E-118
sp|Q6BZX4|TFB2_YARLI RNA polymerase II transcription factor B subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB2 PE=3 SV=1 10 491 7.0E-118
sp|P87303|TFB2_SCHPO RNA polymerase II transcription factor B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb2 PE=1 SV=2 10 489 6.0E-114
sp|Q6CLR2|TFB2_KLULA RNA polymerase II transcription factor B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB2 PE=3 SV=1 1 485 3.0E-113
sp|Q6BGW8|TFB2_DEBHA RNA polymerase II transcription factor B subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB2 PE=3 SV=2 1 485 1.0E-110
sp|Q6FP41|TFB2_CANGA RNA polymerase II transcription factor B subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TFB2 PE=3 SV=1 10 493 7.0E-107
sp|Q02939|TFB2_YEAST RNA polymerase II transcription factor B subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB2 PE=1 SV=1 10 493 4.0E-103
sp|O70422|TF2H4_MOUSE General transcription factor IIH subunit 4 OS=Mus musculus GN=Gtf2h4 PE=1 SV=1 6 492 5.0E-86
sp|P60027|TF2H4_PANTR General transcription factor IIH subunit 4 OS=Pan troglodytes GN=GTF2H4 PE=3 SV=1 6 492 6.0E-86
sp|Q92759|TF2H4_HUMAN General transcription factor IIH subunit 4 OS=Homo sapiens GN=GTF2H4 PE=2 SV=1 6 492 6.0E-86
sp|Q54C29|TF2H4_DICDI General transcription factor IIH subunit 4 OS=Dictyostelium discoideum GN=gtf2h4 PE=3 SV=1 13 487 6.0E-59
[Show less]

GO

GO Term Description Terminal node
GO:0001671 ATPase activator activity Yes
GO:0000439 transcription factor TFIIH core complex Yes
GO:0006289 nucleotide-excision repair Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006281 DNA repair No
GO:0090575 RNA polymerase II transcription regulator complex No
GO:0032991 protein-containing complex No
GO:0006950 response to stress No
GO:0071704 organic substance metabolic process No
GO:0051716 cellular response to stimulus No
GO:0098772 molecular function regulator activity No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0050896 response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0140513 nuclear protein-containing complex No
GO:0044238 primary metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0003674 molecular_function No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0005667 transcription regulator complex No
GO:0140677 molecular function activator activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.508 0.5997 0.0288 0.0517 0.0877 0.0093 0.0577 0.3035 0.1169 0.0102

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2735
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|906
Ophiocordyceps australis map64 (Brazil) OphauB2|6986
Ophiocordyceps camponoti-floridani Ophcf2|01079
Ophiocordyceps camponoti-rufipedis Ophun1|5557
Ophiocordyceps kimflemingae Ophio5|5135
Ophiocordyceps subramaniannii Hirsu2|432 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|432
MAVNSIQSLSLSEYLEKLPGTTFRKLYQQPSSAFAIFRRMLPHLAKTLVMRMLFMPNPMTLSDLDLWFRPEAKRQ
KDQVLSILRGLHIIQITAPSKDKPQELYLTANFKTSFRLALTGGGSHNSFGVPSTLAVPPEIDVVFLDRYARKKW
DDILHFVVSSVGFKSTVDVSGPNKSVKELLIAGRLVDRRPNGGVGITQAGFTFLLQEANAQVWTLLLLWLEASES
NRAMGLETVDMLSFLFVLASLELGRAYDTNALTEQRKNMLPSLLDFGLIYIPQHKRSMFFPTRLATTLTSGGGGS
LRSISEGVAAATAAASNPAQGGGPTGGSGDQKGGLIVETNYRIYAYTQSTLQIAVLALFTKLQMRFPDMVAGRLS
RASIRQAINFGITADQIISYLAAHAHDQMHRNAALANKPVLPPTVVDQIRLWQLENERMKTTGGFLFRDFDDHKE
YLDTAKFAEEIGVLVWRSDKSGMFFANKHEQIRDYLKSRKKAE*
Coding >Hirsu2|432
ATGGCCGTCAATTCGATACAGTCGCTCTCGCTCTCGGAGTACCTCGAGAAGCTCCCCGGTACGACATTTAGGAAG
CTCTACCAGCAGCCTTCGTCAGCATTTGCCATCTTCAGGCGGATGCTCCCGCATCTAGCCAAAACCCTCGTTATG
CGCATGTTGTTCATGCCCAACCCCATGACCCTGAGCGACTTGGATCTCTGGTTCAGGCCCGAGGCGAAGCGGCAA
AAAGACCAGGTGCTCTCGATCCTTCGCGGCCTCCACATCATCCAGATCACGGCCCCGTCCAAGGATAAGCCGCAG
GAGCTGTACCTAACGGCCAACTTCAAGACCTCGTTCCGCTTGGCCCTCACCGGCGGCGGCAGCCACAACTCCTTC
GGCGTCCCGTCCACACTGGCGGTTCCGCCCGAGATCGACGTCGTCTTCCTCGACCGGTACGCGCGCAAGAAATGG
GACGACATCCTGCACTTCGTCGTCTCCAGCGTCGGTTTCAAAAGTACCGTCGATGTGTCCGGTCCTAATAAGAGT
GTCAAGGAGCTGCTGATTGCCGGCCGTCTGGTTGACAGGAGGCCCAACGGCGGCGTCGGCATCACCCAGGCCGGC
TTCACCTTCCTGCTGCAGGAAGCCAACGCTCAGGTGTGGACCCTGCTGCTCCTCTGGCTCGAGGCCAGCGAGAGC
AACCGGGCTATGGGCCTCGAGACGGTCGACATGCTCTCCTTCCTCTTCGTCCTCGCCAGCCTCGAGCTCGGAAGG
GCCTACGATACCAACGCGCTGACCGAGCAGCGCAAGAACATGCTGCCTTCCCTCCTCGACTTTGGCCTCATTTAC
ATTCCCCAGCACAAACGTTCCATGTTCTTCCCGACCCGCCTCGCCACCACACTTACCAGCGGTGGTGGCGGCAGC
CTGCGGAGCATCAGCGAGGGCGTCGCGGCCGCCACGGCAGCCGCCTCCAACCCGGCGCAAGGCGGCGGTCCCACG
GGAGGCTCCGGCGATCAAAAGGGCGGCCTCATCGTCGAGACCAACTACCGCATCTACGCCTACACGCAGTCGACG
CTCCAGATCGCCGTCCTCGCCCTCTTCACCAAGCTCCAGATGCGCTTCCCCGACATGGTGGCCGGCCGTCTGTCG
CGTGCCTCGATCCGGCAGGCCATCAACTTTGGCATCACGGCCGACCAGATCATCTCGTACCTGGCCGCCCACGCC
CACGACCAGATGCACCGCAACGCCGCCCTCGCCAACAAGCCCGTCCTGCCGCCGACCGTCGTCGACCAGATCCGG
CTGTGGCAGCTCGAGAACGAGCGGATGAAGACGACGGGCGGCTTCCTCTTTCGCGACTTTGACGACCACAAGGAG
TACCTCGACACGGCCAAGTTTGCCGAGGAGATTGGCGTCCTGGTCTGGCGCAGCGACAAGTCGGGCATGTTCTTC
GCCAACAAGCACGAGCAGATACGGGACTACCTCAAGAGCCGAAAGAAGGCCGAGTAG
Transcript >Hirsu2|432
ATGGCCGTCAATTCGATACAGTCGCTCTCGCTCTCGGAGTACCTCGAGAAGCTCCCCGGTACGACATTTAGGAAG
CTCTACCAGCAGCCTTCGTCAGCATTTGCCATCTTCAGGCGGATGCTCCCGCATCTAGCCAAAACCCTCGTTATG
CGCATGTTGTTCATGCCCAACCCCATGACCCTGAGCGACTTGGATCTCTGGTTCAGGCCCGAGGCGAAGCGGCAA
AAAGACCAGGTGCTCTCGATCCTTCGCGGCCTCCACATCATCCAGATCACGGCCCCGTCCAAGGATAAGCCGCAG
GAGCTGTACCTAACGGCCAACTTCAAGACCTCGTTCCGCTTGGCCCTCACCGGCGGCGGCAGCCACAACTCCTTC
GGCGTCCCGTCCACACTGGCGGTTCCGCCCGAGATCGACGTCGTCTTCCTCGACCGGTACGCGCGCAAGAAATGG
GACGACATCCTGCACTTCGTCGTCTCCAGCGTCGGTTTCAAAAGTACCGTCGATGTGTCCGGTCCTAATAAGAGT
GTCAAGGAGCTGCTGATTGCCGGCCGTCTGGTTGACAGGAGGCCCAACGGCGGCGTCGGCATCACCCAGGCCGGC
TTCACCTTCCTGCTGCAGGAAGCCAACGCTCAGGTGTGGACCCTGCTGCTCCTCTGGCTCGAGGCCAGCGAGAGC
AACCGGGCTATGGGCCTCGAGACGGTCGACATGCTCTCCTTCCTCTTCGTCCTCGCCAGCCTCGAGCTCGGAAGG
GCCTACGATACCAACGCGCTGACCGAGCAGCGCAAGAACATGCTGCCTTCCCTCCTCGACTTTGGCCTCATTTAC
ATTCCCCAGCACAAACGTTCCATGTTCTTCCCGACCCGCCTCGCCACCACACTTACCAGCGGTGGTGGCGGCAGC
CTGCGGAGCATCAGCGAGGGCGTCGCGGCCGCCACGGCAGCCGCCTCCAACCCGGCGCAAGGCGGCGGTCCCACG
GGAGGCTCCGGCGATCAAAAGGGCGGCCTCATCGTCGAGACCAACTACCGCATCTACGCCTACACGCAGTCGACG
CTCCAGATCGCCGTCCTCGCCCTCTTCACCAAGCTCCAGATGCGCTTCCCCGACATGGTGGCCGGCCGTCTGTCG
CGTGCCTCGATCCGGCAGGCCATCAACTTTGGCATCACGGCCGACCAGATCATCTCGTACCTGGCCGCCCACGCC
CACGACCAGATGCACCGCAACGCCGCCCTCGCCAACAAGCCCGTCCTGCCGCCGACCGTCGTCGACCAGATCCGG
CTGTGGCAGCTCGAGAACGAGCGGATGAAGACGACGGGCGGCTTCCTCTTTCGCGACTTTGACGACCACAAGGAG
TACCTCGACACGGCCAAGTTTGCCGAGGAGATTGGCGTCCTGGTCTGGCGCAGCGACAAGTCGGGCATGTTCTTC
GCCAACAAGCACGAGCAGATACGGGACTACCTCAAGAGCCGAAAGAAGGCCGAGTAG
Gene >Hirsu2|432
ATGGCCGTCAATTCGATACAGTCGCTCTCGCTCTCGGAGTACCTCGAGAAGCTCCCCGGTACGACATTTAGGAAG
CTCTACCAGCAGCCTTCGTCAGCATTTGCCATCTTCAGGCGGATGCTCCCGCATCTAGGTGAGTCGAGACGCCTT
TGCGCACTCTCGGGCCGAGATGCGGGCTGCGGGCTAAGCGGACGCAGCCAAAACCCTCGTTATGCGCATGTTGTT
CATGCCCAACCCCATGACCCTGAGCGACTTGGATCTCTGGTTCAGGCCCGAGGCGAAGCGGTACCGACATGGCCT
TCTTCCCCGGGTCCCGCTCGTTCGTGGCCGAGGCTGACGCTGTTTATGTAGGCAAAAAGACCAGGTGCTCTCGAT
CCTTCGCGGCCTCCACATCATCCAGATCACGGCCCCGTCCAAGGATAAGCCGCAGGAGCTGTACCTAACGGCCAA
CTTCAAGACCTCGTTCCGCTTGGCCCTCACCGGCGGCGGCAGCCACAACTCCTTCGGCGTCCCGTCCACACTGGC
GGTTCCGCCCGAGATCGACGTCGTCTTCCTCGACCGGTACGCGCGCAAGAAATGGGACGACATCCTGCACTTCGT
CGTCTCCAGCGTCGGTTTCAAAAGTACCGTCGATGTGTCCGGTCCTAATAAGAGTGTCAAGGAGCTGCTGATTGC
CGGCCGTCTGGTTGACAGGAGGCCCAACGGCGGCGTCGGCATCACCCAGGCCGGCTTCACCTTCCTGCTGCAGGA
AGCCAACGCTCAGGTGTGGACCCTGCTGCTCCTCTGGCTCGAGGCCAGCGAGAGCAACCGGGCTATGGGCCTCGA
GACGGTCGACATGCTCTCCTTCCTCTTCGTCCTCGCCAGCCTCGAGCTCGGAAGGGCCTACGATACCAACGCGCT
GACCGAGCAGCGCAAGAACATGCTGCCTTCCCTCCTCGACTTTGGCCTCATTTACATTCCCCAGCACAAACGTTC
CATGTTCTTCCCGACCCGCCTCGCCACCACACTTACCAGCGGTGGTGGCGGCAGCCTGCGGAGCATCAGCGAGGG
CGTCGCGGCCGCCACGGCAGCCGCCTCCAACCCGGCGCAAGGCGGCGGTCCCACGGGAGGCTCCGGCGATCAAAA
GGGCGGCCTCATCGTCGAGACCAACTACCGCATCTACGCCTACACGCAGTCGACGCTCCAGATCGCCGTCCTCGC
CCTCTTCACCAAGCTCCAGATGCGCTTCCCCGACATGGTGGCCGGCCGTCTGTCGCGTGCCTCGATCCGGCAGGC
CATCAACTTTGGCATCACGGCCGACCAGATCATCTCGTACCTGGCCGCCCACGCCCACGACCAGATGCACCGCAA
CGCCGCCCTCGCCAACAAGCCCGTCCTGCCGCCGACCGTCGTCGACCAGATCCGGCTGTGGCAGCTCGAGAACGA
GCGGATGAAGACGACGGGCGGCTTCCTCTTTCGCGACTTTGACGACCACAAGGAGTACCTCGACACGGCCAAGTT
TGCCGAGGAGATTGGCGTCCTGGTCTGGCGCAGCGACAAGTCGGGCATGTTCTTCGCCAACAAGCACGAGCAGAT
ACGGGACTACCTCAAGAGCCGAAAGAAGGCCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail