Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4317
Gene name
LocationContig_2203:487..3190
Strand+
Gene length (bp)2703
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 1.3E-162 3 658
PF06723 MreB_Mbl MreB/Mbl protein 1.4E-13 113 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74225|HSP88_NEUCR Heat shock protein hsp88 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp88 PE=1 SV=1 1 670 0.0E+00
sp|O59838|HSP7F_SCHPO Heat shock protein homolog pss1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pss1 PE=1 SV=2 2 688 0.0E+00
sp|Q96VB9|HSP7F_CANAL Heat shock protein homolog SSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSI3 PE=1 SV=2 1 661 0.0E+00
sp|Q875P5|HSP7F_LACK1 Heat shock protein homolog SSE1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SSE1 PE=3 SV=1 1 697 0.0E+00
sp|Q6FJI3|HSP7F_CANGA Heat shock protein homolog SSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSE1 PE=3 SV=1 5 689 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74225|HSP88_NEUCR Heat shock protein hsp88 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp88 PE=1 SV=1 1 670 0.0E+00
sp|O59838|HSP7F_SCHPO Heat shock protein homolog pss1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pss1 PE=1 SV=2 2 688 0.0E+00
sp|Q96VB9|HSP7F_CANAL Heat shock protein homolog SSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSI3 PE=1 SV=2 1 661 0.0E+00
sp|Q875P5|HSP7F_LACK1 Heat shock protein homolog SSE1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SSE1 PE=3 SV=1 1 697 0.0E+00
sp|Q6FJI3|HSP7F_CANGA Heat shock protein homolog SSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSE1 PE=3 SV=1 5 689 0.0E+00
sp|Q875V0|HSP7F_NAUCC Heat shock protein homolog SSE1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SSE1 PE=3 SV=1 5 696 0.0E+00
sp|Q74ZJ0|HSP7F_ASHGO Heat shock protein homolog SSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSE1 PE=3 SV=1 1 690 0.0E+00
sp|P32590|HSP79_YEAST Heat shock protein homolog SSE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSE2 PE=1 SV=3 5 690 0.0E+00
sp|P32589|HSP7F_YEAST Heat shock protein homolog SSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSE1 PE=1 SV=4 5 679 0.0E+00
sp|Q61316|HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus GN=Hspa4 PE=1 SV=1 1 663 0.0E+00
sp|O88600|HSP74_RAT Heat shock 70 kDa protein 4 OS=Rattus norvegicus GN=Hspa4 PE=1 SV=1 1 663 0.0E+00
sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens GN=HSPA4 PE=1 SV=4 1 663 0.0E+00
sp|Q5RDM4|HSP74_PONAB Heat shock 70 kDa protein 4 OS=Pongo abelii GN=HSPA4 PE=2 SV=1 1 663 0.0E+00
sp|Q2TFN9|HSP74_CANLF Heat shock 70 kDa protein 4 OS=Canis lupus familiaris GN=HSPA4 PE=1 SV=1 1 663 0.0E+00
sp|P48722|HS74L_MOUSE Heat shock 70 kDa protein 4L OS=Mus musculus GN=Hspa4l PE=1 SV=2 1 663 0.0E+00
sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens GN=HSPA4L PE=1 SV=3 1 663 0.0E+00
sp|Q61699|HS105_MOUSE Heat shock protein 105 kDa OS=Mus musculus GN=Hsph1 PE=1 SV=2 1 671 4.0E-174
sp|Q92598|HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens GN=HSPH1 PE=1 SV=1 1 671 3.0E-172
sp|Q5R606|HS105_PONAB Heat shock protein 105 kDa OS=Pongo abelii GN=HSPH1 PE=2 SV=1 1 671 3.0E-172
sp|Q0IIM3|HS105_BOVIN Heat shock protein 105 kDa OS=Bos taurus GN=HSPH1 PE=2 SV=1 1 671 1.0E-170
sp|Q66HA8|HS105_RAT Heat shock protein 105 kDa OS=Rattus norvegicus GN=Hsph1 PE=1 SV=1 1 666 2.0E-170
sp|Q9S7C0|HSP7O_ARATH Heat shock 70 kDa protein 14 OS=Arabidopsis thaliana GN=HSP70-14 PE=2 SV=1 1 663 2.0E-167
sp|F4HQD4|HSP7P_ARATH Heat shock 70 kDa protein 15 OS=Arabidopsis thaliana GN=HSP70-15 PE=1 SV=1 1 663 1.0E-166
sp|Q60446|HS105_CRIGR Heat shock protein 105 kDa OS=Cricetulus griseus GN=HSPH1 PE=2 SV=1 1 671 2.0E-163
sp|Q9SAB1|HSP7Q_ARATH Heat shock 70 kDa protein 16 OS=Arabidopsis thaliana GN=HSP70-16 PE=2 SV=1 1 722 1.0E-161
sp|Q94738|HSP97_STRFN 97 kDa heat shock protein OS=Strongylocentrotus franciscanus GN=HSP110 PE=2 SV=1 1 534 2.0E-152
sp|Q06068|HSP97_STRPU 97 kDa heat shock protein OS=Strongylocentrotus purpuratus PE=1 SV=2 1 536 5.0E-152
sp|Q05036|YLA4_CAEEL Uncharacterized protein C30C11.4 OS=Caenorhabditis elegans GN=C30C11.4 PE=3 SV=1 1 674 4.0E-141
sp|Q6TMK3|HSP88_DICDI Heat shock protein 88 OS=Dictyostelium discoideum GN=hspH PE=1 SV=1 3 657 2.0E-136
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 2 660 2.0E-85
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 2 659 3.0E-85
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 1 657 1.0E-83
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 4 495 2.0E-83
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 4 660 2.0E-83
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 2 657 5.0E-83
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 4 661 8.0E-83
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 2 657 1.0E-82
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 4 659 2.0E-82
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 4 659 5.0E-82
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 4 659 6.0E-82
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 4 655 6.0E-82
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 2 657 7.0E-82
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 4 659 2.0E-81
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 4 660 9.0E-81
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 4 660 1.0E-80
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 4 659 3.0E-80
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 4 660 4.0E-80
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 4 660 5.0E-80
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 4 660 1.0E-79
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 1 660 1.0E-79
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 2 659 3.0E-79
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 2 659 3.0E-79
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 4 660 3.0E-79
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 1 657 4.0E-79
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 4 660 7.0E-79
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 4 661 8.0E-79
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 4 659 8.0E-79
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 2 659 8.0E-79
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 2 655 9.0E-79
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 4 659 1.0E-78
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 4 660 1.0E-78
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 4 660 1.0E-78
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 2 493 2.0E-78
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 2 493 2.0E-78
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 2 493 2.0E-78
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 4 493 2.0E-78
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 2 493 2.0E-78
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 2 659 3.0E-78
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 1 660 3.0E-78
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 1 661 3.0E-78
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 4 660 3.0E-78
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 1 661 3.0E-78
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 2 493 3.0E-78
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 1 661 4.0E-78
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 4 660 4.0E-78
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 2 659 4.0E-78
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 4 655 4.0E-78
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 4 669 5.0E-78
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 1 661 5.0E-78
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 1 661 5.0E-78
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 1 661 5.0E-78
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 1 661 6.0E-78
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 4 495 6.0E-78
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 4 493 7.0E-78
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 4 660 7.0E-78
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 4 660 7.0E-78
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 4 660 7.0E-78
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 4 660 7.0E-78
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 4 660 7.0E-78
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 4 660 8.0E-78
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 4 659 8.0E-78
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 4 660 8.0E-78
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 1 661 8.0E-78
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 1 661 8.0E-78
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 4 660 9.0E-78
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 4 544 1.0E-77
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 4 660 1.0E-77
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 4 660 1.0E-77
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 2 655 1.0E-77
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 2 655 1.0E-77
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 4 659 2.0E-77
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 4 660 2.0E-77
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 4 660 2.0E-77
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 4 468 2.0E-77
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 4 382 2.0E-77
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 4 660 3.0E-77
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 4 660 3.0E-77
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 2 659 3.0E-77
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 4 657 4.0E-77
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 4 659 6.0E-77
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 4 493 9.0E-77
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 4 660 1.0E-76
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 2 395 1.0E-76
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 2 655 2.0E-76
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 2 655 2.0E-76
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 4 660 2.0E-76
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 4 660 2.0E-76
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 2 661 2.0E-76
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 4 655 2.0E-76
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 4 659 2.0E-76
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 2 661 2.0E-76
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 4 660 3.0E-76
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 4 660 4.0E-76
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 4 659 4.0E-76
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 2 660 4.0E-76
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 4 382 4.0E-76
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 4 659 5.0E-76
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 1 468 8.0E-76
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 4 495 1.0E-75
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 4 468 1.0E-75
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 4 665 1.0E-75
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 2 661 1.0E-75
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 4 468 2.0E-75
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 4 468 2.0E-75
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 2 661 3.0E-75
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 4 660 3.0E-75
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 4 468 6.0E-75
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 2 660 7.0E-75
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 4 495 9.0E-75
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 4 660 1.0E-74
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 4 659 1.0E-74
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 4 468 2.0E-74
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 2 661 3.0E-74
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 4 659 4.0E-74
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 4 382 5.0E-74
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 4 628 6.0E-74
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 2 661 7.0E-74
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 4 468 8.0E-74
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 4 468 9.0E-74
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 4 660 1.0E-73
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 4 468 3.0E-73
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 2 661 3.0E-73
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 2 660 3.0E-73
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 2 661 5.0E-73
sp|F4JMJ1|HSP7R_ARATH Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana GN=HSP70-17 PE=2 SV=1 2 660 6.0E-73
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 2 661 8.0E-73
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 4 660 9.0E-73
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 2 659 2.0E-72
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 2 661 2.0E-72
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 4 665 3.0E-72
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 4 660 5.0E-72
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 2 659 5.0E-72
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 2 659 9.0E-72
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 2 665 2.0E-71
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 2 665 2.0E-71
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 2 665 2.0E-71
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 4 660 2.0E-71
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 4 660 4.0E-71
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 4 493 4.0E-71
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 2 659 1.0E-70
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 2 659 1.0E-70
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 2 659 1.0E-70
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 2 659 2.0E-70
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 2 659 2.0E-70
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 2 659 3.0E-70
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 2 659 5.0E-70
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 4 495 8.0E-70
sp|Q9XCB1|DNAK_RHOMR Chaperone protein DnaK OS=Rhodothermus marinus GN=dnaK PE=3 SV=1 3 468 2.0E-69
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 3 468 4.0E-69
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 2 468 7.0E-69
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 4 662 9.0E-69
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 4 659 1.0E-68
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 4 660 1.0E-68
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 4 660 2.0E-68
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 2 664 3.0E-68
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 2 671 3.0E-68
sp|Q05866|GRP78_PLAFO 78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1 3 659 6.0E-67
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 2 661 6.0E-67
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 5 495 8.0E-67
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 4 493 1.0E-66
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 4 660 2.0E-66
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 2 660 2.0E-66
sp|Q4FNP9|DNAK_PELUB Chaperone protein DnaK OS=Pelagibacter ubique (strain HTCC1062) GN=dnaK PE=3 SV=1 3 520 2.0E-66
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 3 527 3.0E-66
sp|Q7ZUW2|HYOU1_DANRE Hypoxia up-regulated protein 1 OS=Danio rerio GN=hyou1 PE=2 SV=1 1 436 4.0E-66
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 3 684 5.0E-66
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 3 405 6.0E-66
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 2 671 6.0E-66
sp|P22623|HSP72_PARLI Heat shock 70 kDa protein II (Fragment) OS=Paracentrotus lividus GN=HSP70II PE=3 SV=1 4 371 7.0E-66
sp|Q566I3|HYOU1_XENLA Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus laevis GN=hyou1 PE=1 SV=2 1 511 1.0E-65
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 2 660 1.0E-65
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 4 660 2.0E-65
sp|Q2RNE6|DNAK_RHORT Chaperone protein DnaK OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=dnaK PE=3 SV=1 3 533 2.0E-65
sp|P14834|HSP70_LEIMA Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1 4 382 3.0E-65
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 3 405 3.0E-65
sp|Q2KDW6|DNAK_RHIEC Chaperone protein DnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=3 SV=1 3 617 3.0E-65
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 4 660 5.0E-65
sp|A4WW89|DNAK_RHOS5 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=3 SV=1 3 544 1.0E-64
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 2 660 1.0E-64
sp|P42374|DNAK_RHIME Chaperone protein DnaK OS=Rhizobium meliloti (strain 1021) GN=dnaK PE=3 SV=2 3 532 1.0E-64
sp|B3PXH3|DNAK_RHIE6 Chaperone protein DnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=3 SV=1 3 617 2.0E-64
sp|Q3IYM7|DNAK_RHOS4 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=3 SV=1 3 405 2.0E-64
sp|A3PNM1|DNAK_RHOS1 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=3 SV=1 3 405 2.0E-64
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 3 468 2.0E-64
sp|A6UEY0|DNAK_SINMW Chaperone protein DnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=3 SV=1 3 532 3.0E-64
sp|Q5FFM4|DNAK_EHRRG Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Gardel) GN=dnaK PE=3 SV=1 1 468 5.0E-64
sp|Q63617|HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus GN=Hyou1 PE=1 SV=1 1 506 5.0E-64
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 3 405 6.0E-64
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 3 405 7.0E-64
sp|B5ZWQ2|DNAK_RHILW Chaperone protein DnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=3 SV=1 3 634 8.0E-64
sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus norvegicus GN=Hspa9 PE=1 SV=3 2 468 8.0E-64
sp|Q5FSL5|DNAK_GLUOX Chaperone protein DnaK OS=Gluconobacter oxydans (strain 621H) GN=dnaK PE=3 SV=1 3 495 8.0E-64
sp|Q9JKR6|HYOU1_MOUSE Hypoxia up-regulated protein 1 OS=Mus musculus GN=Hyou1 PE=1 SV=1 1 506 8.0E-64
sp|Q3YRR6|DNAK_EHRCJ Chaperone protein DnaK OS=Ehrlichia canis (strain Jake) GN=dnaK PE=3 SV=1 1 468 8.0E-64
sp|Q5HAY1|DNAK_EHRRW Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaK PE=3 SV=1 1 468 9.0E-64
sp|Q8K9Y8|DNAK_BUCAP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaK PE=3 SV=1 3 468 9.0E-64
sp|Q1MN11|DNAK_RHIL3 Chaperone protein DnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=3 SV=1 3 669 9.0E-64
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 2 468 1.0E-63
sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1 2 468 1.0E-63
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 3 468 2.0E-63
sp|Q01899|HSP7M_PHAVU Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1 3 381 2.0E-63
sp|Q2SMM8|DNAK_HAHCH Chaperone protein DnaK OS=Hahella chejuensis (strain KCTC 2396) GN=dnaK PE=3 SV=1 3 468 2.0E-63
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 3 405 2.0E-63
sp|P0C937|DNAK_PORGI Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaK PE=3 SV=1 3 493 2.0E-63
sp|B2RJ90|DNAK_PORG3 Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaK PE=3 SV=1 3 493 2.0E-63
sp|Q9LDZ0|HSP7J_ARATH Heat shock 70 kDa protein 10, mitochondrial OS=Arabidopsis thaliana GN=HSP70-10 PE=2 SV=1 3 381 2.0E-63
sp|B8F7S6|DNAK_HAEPS Chaperone protein DnaK OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaK PE=3 SV=1 3 520 2.0E-63
sp|Q0VA61|HYOU1_XENTR Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus tropicalis GN=hyou1 PE=2 SV=2 1 511 3.0E-63
sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2 2 468 3.0E-63
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 4 381 6.0E-63
sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1 2 468 6.0E-63
sp|B8CKF3|DNAK_SHEPW Chaperone protein DnaK OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaK PE=3 SV=1 3 469 6.0E-63
sp|B8GNX1|DNAK_THISH Chaperone protein DnaK OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaK PE=3 SV=1 3 520 7.0E-63
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 3 533 8.0E-63
sp|A0L4Z2|DNAK_MAGMM Chaperone protein DnaK OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dnaK PE=3 SV=1 3 405 1.0E-62
sp|P29845|HSP7E_DROME Heat shock 70 kDa protein cognate 5 OS=Drosophila melanogaster GN=Hsc70-5 PE=1 SV=2 2 382 1.0E-62
sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1 2 468 1.0E-62
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 3 381 1.0E-62
sp|C6BSF2|DNAK_DESAD Chaperone protein DnaK OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaK PE=3 SV=1 3 495 1.0E-62
sp|A7FME3|DNAK_YERP3 Chaperone protein DnaK OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaK PE=3 SV=1 3 495 2.0E-62
sp|Q52701|DNAK_RHOCA Chaperone protein DnaK OS=Rhodobacter capsulatus GN=dnaK PE=3 SV=1 3 405 2.0E-62
sp|P37900|HSP7M_PEA Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1 3 381 2.0E-62
sp|Q60432|HYOU1_CRIGR Hypoxia up-regulated protein 1 OS=Cricetulus griseus GN=HYOU1 PE=2 SV=1 1 506 2.0E-62
sp|A8ZRW3|DNAK_DESOH Chaperone protein DnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=3 SV=1 4 470 2.0E-62
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 3 468 2.0E-62
sp|B4S6P7|DNAK_PROA2 Chaperone protein DnaK OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaK PE=3 SV=1 3 382 2.0E-62
sp|Q93GF1|DNAK_PRELO Chaperone protein DnaK OS=Prevotella loescheii GN=dnaK PE=3 SV=1 3 495 2.0E-62
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 3 468 2.0E-62
sp|A3QGW2|DNAK_SHELP Chaperone protein DnaK OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaK PE=3 SV=1 3 469 2.0E-62
sp|C5BQ33|DNAK_TERTT Chaperone protein DnaK OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaK PE=3 SV=1 3 520 2.0E-62
sp|Q8DI58|DNAK2_THEEB Chaperone protein dnaK2 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK2 PE=3 SV=1 3 493 3.0E-62
sp|A5FZ19|DNAK_ACICJ Chaperone protein DnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=3 SV=1 3 434 3.0E-62
sp|Q3SIN4|DNAK_THIDA Chaperone protein DnaK OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaK PE=3 SV=1 3 405 3.0E-62
sp|Q08276|HSP7M_SOLTU Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum GN=HSP68 PE=2 SV=1 3 381 3.0E-62
sp|B5Y242|DNAK_KLEP3 Chaperone protein DnaK OS=Klebsiella pneumoniae (strain 342) GN=dnaK PE=3 SV=1 3 590 4.0E-62
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 3 532 4.0E-62
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 3 532 4.0E-62
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 3 532 5.0E-62
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 3 532 5.0E-62
sp|Q47XI6|DNAK2_COLP3 Chaperone protein DnaK 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaK2 PE=3 SV=1 3 469 6.0E-62
sp|P83784|HSP77_CANAL Heat shock protein SSC1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSC1 PE=1 SV=2 3 526 6.0E-62
sp|A1JJD5|DNAK_YERE8 Chaperone protein DnaK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaK PE=3 SV=1 3 469 6.0E-62
sp|B8FGS3|DNAK_DESAA Chaperone protein DnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=3 SV=1 3 520 7.0E-62
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 3 381 7.0E-62
sp|B1JL04|DNAK_YERPY Chaperone protein DnaK OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaK PE=3 SV=1 3 469 7.0E-62
sp|Q66ET0|DNAK_YERPS Chaperone protein DnaK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaK PE=3 SV=1 3 469 7.0E-62
sp|A4TQF9|DNAK_YERPP Chaperone protein DnaK OS=Yersinia pestis (strain Pestoides F) GN=dnaK PE=3 SV=1 3 469 7.0E-62
sp|Q1CMV7|DNAK_YERPN Chaperone protein DnaK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaK PE=3 SV=1 3 469 7.0E-62
sp|A9R015|DNAK_YERPG Chaperone protein DnaK OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaK PE=3 SV=1 3 469 7.0E-62
sp|Q8ZIM7|DNAK_YERPE Chaperone protein DnaK OS=Yersinia pestis GN=dnaK PE=3 SV=1 3 469 7.0E-62
sp|B2K3M0|DNAK_YERPB Chaperone protein DnaK OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaK PE=3 SV=1 3 469 7.0E-62
sp|Q1C0J9|DNAK_YERPA Chaperone protein DnaK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaK PE=3 SV=1 3 469 7.0E-62
sp|Q2G6N0|DNAK_NOVAD Chaperone protein DnaK OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dnaK PE=3 SV=1 3 495 7.0E-62
sp|A7ZVV7|DNAK_ECOHS Chaperone protein DnaK OS=Escherichia coli O9:H4 (strain HS) GN=dnaK PE=3 SV=1 3 590 7.0E-62
sp|Q3B577|DNAK_CHLL7 Chaperone protein DnaK OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaK PE=3 SV=1 3 381 8.0E-62
sp|B0TQC2|DNAK_SHEHH Chaperone protein DnaK OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaK PE=3 SV=1 3 470 1.0E-61
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 3 495 1.0E-61
sp|A7MIK5|DNAK_CROS8 Chaperone protein DnaK OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaK PE=3 SV=1 3 405 1.0E-61
sp|A9MR77|DNAK_SALAR Chaperone protein DnaK OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 3 468 1.0E-61
sp|B5R5I2|DNAK_SALEP Chaperone protein DnaK OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|Q3Z601|DNAK_SHISS Chaperone protein DnaK OS=Shigella sonnei (strain Ss046) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|Q32KA5|DNAK_SHIDS Chaperone protein DnaK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|Q326K7|DNAK_SHIBS Chaperone protein DnaK OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|Q1RGI8|DNAK_ECOUT Chaperone protein DnaK OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|P0A6Y8|DNAK_ECOLI Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2 3 590 1.0E-61
sp|B1IRG0|DNAK_ECOLC Chaperone protein DnaK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|P0A6Y9|DNAK_ECOL6 Chaperone protein DnaK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaK PE=3 SV=2 3 590 1.0E-61
sp|Q0TLX5|DNAK_ECOL5 Chaperone protein DnaK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|A1A766|DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|P0A6Z0|DNAK_ECO57 Chaperone protein DnaK OS=Escherichia coli O157:H7 GN=dnaK PE=3 SV=2 3 590 1.0E-61
sp|A7ZHA4|DNAK_ECO24 Chaperone protein DnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|B1LZ51|DNAK_METRJ Chaperone protein DnaK OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaK PE=3 SV=1 3 532 1.0E-61
sp|A6T4F4|DNAK_KLEP7 Chaperone protein DnaK OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|A4W6D5|DNAK_ENT38 Chaperone protein DnaK OS=Enterobacter sp. (strain 638) GN=dnaK PE=3 SV=1 3 590 1.0E-61
sp|A8H760|DNAK_SHEPA Chaperone protein DnaK OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaK PE=3 SV=1 3 470 2.0E-61
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 3 381 2.0E-61
sp|Q5ZM98|GRP75_CHICK Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1 2 468 2.0E-61
sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens GN=HYOU1 PE=1 SV=1 1 506 2.0E-61
sp|Q83MH5|DNAK_SHIFL Chaperone protein DnaK OS=Shigella flexneri GN=dnaK PE=3 SV=1 3 590 2.0E-61
sp|Q0T8H6|DNAK_SHIF8 Chaperone protein DnaK OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaK PE=3 SV=1 3 590 2.0E-61
sp|B8D758|DNAK_BUCAT Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaK PE=3 SV=1 3 544 2.0E-61
sp|O32464|DNAK_BUCAI Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaK PE=3 SV=1 3 544 2.0E-61
sp|B8D8V4|DNAK_BUCA5 Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaK PE=3 SV=1 3 544 2.0E-61
sp|O52064|DNAK_MANHA Chaperone protein DnaK OS=Mannheimia haemolytica GN=dnaK PE=3 SV=1 3 520 2.0E-61
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 3 495 3.0E-61
sp|Q493S7|DNAK_BLOPB Chaperone protein DnaK OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaK PE=3 SV=1 3 470 3.0E-61
sp|A8ALU3|DNAK_CITK8 Chaperone protein DnaK OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dnaK PE=3 SV=1 3 590 3.0E-61
sp|B0UR84|DNAK_METS4 Chaperone protein DnaK OS=Methylobacterium sp. (strain 4-46) GN=dnaK PE=3 SV=1 3 381 3.0E-61
sp|Q8Z9R1|DNAK_SALTI Chaperone protein DnaK OS=Salmonella typhi GN=dnaK PE=3 SV=3 3 590 3.0E-61
sp|B4TVZ5|DNAK_SALSV Chaperone protein DnaK OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaK PE=3 SV=1 3 590 3.0E-61
sp|B5BLH8|DNAK_SALPK Chaperone protein DnaK OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaK PE=3 SV=1 3 590 3.0E-61
sp|Q5PDJ5|DNAK_SALPA Chaperone protein DnaK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaK PE=3 SV=1 3 590 3.0E-61
sp|B4TIB4|DNAK_SALHS Chaperone protein DnaK OS=Salmonella heidelberg (strain SL476) GN=dnaK PE=3 SV=1 3 590 3.0E-61
sp|B5F6Y8|DNAK_SALA4 Chaperone protein DnaK OS=Salmonella agona (strain SL483) GN=dnaK PE=3 SV=1 3 590 3.0E-61
sp|Q57TP3|DNAK_SALCH Chaperone protein DnaK OS=Salmonella choleraesuis (strain SC-B67) GN=dnaK PE=3 SV=1 3 590 3.0E-61
sp|Q6F6N3|DNAK_ACIAD Chaperone protein DnaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaK PE=3 SV=1 3 382 3.0E-61
sp|P20442|DNAK_CAUCR Chaperone protein DnaK OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaK PE=2 SV=2 3 381 3.0E-61
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 3 381 4.0E-61
sp|Q56073|DNAK_SALTY Chaperone protein DnaK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaK PE=3 SV=2 3 590 4.0E-61
sp|C0Q4F3|DNAK_SALPC Chaperone protein DnaK OS=Salmonella paratyphi C (strain RKS4594) GN=dnaK PE=3 SV=1 3 590 4.0E-61
sp|A9MXI2|DNAK_SALPB Chaperone protein DnaK OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaK PE=3 SV=1 3 590 4.0E-61
sp|B4T6D6|DNAK_SALNS Chaperone protein DnaK OS=Salmonella newport (strain SL254) GN=dnaK PE=3 SV=1 3 590 4.0E-61
sp|B5RF08|DNAK_SALG2 Chaperone protein DnaK OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaK PE=3 SV=1 3 590 4.0E-61
sp|B5FHA6|DNAK_SALDC Chaperone protein DnaK OS=Salmonella dublin (strain CT_02021853) GN=dnaK PE=3 SV=1 3 590 4.0E-61
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 3 405 4.0E-61
sp|P39987|HSP7E_YEAST Heat shock protein SSC3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM10 PE=3 SV=1 2 530 5.0E-61
sp|Q5LWJ6|DNAK_RUEPO Chaperone protein DnaK OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaK PE=3 SV=1 3 405 5.0E-61
sp|Q1RHH0|DNAK_RICBR Chaperone protein DnaK OS=Rickettsia bellii (strain RML369-C) GN=dnaK PE=3 SV=1 3 526 5.0E-61
sp|Q9ZDX9|DNAK_RICPR Chaperone protein DnaK OS=Rickettsia prowazekii (strain Madrid E) GN=dnaK PE=3 SV=1 3 527 5.0E-61
sp|O87712|DNAK_COXBU Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaK PE=1 SV=1 3 520 5.0E-61
sp|A9N8H2|DNAK_COXBR Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaK PE=3 SV=1 3 520 5.0E-61
sp|A9KG88|DNAK_COXBN Chaperone protein DnaK OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaK PE=3 SV=1 3 520 5.0E-61
sp|B6J7U7|DNAK_COXB1 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaK PE=3 SV=1 3 520 5.0E-61
sp|Q05FS8|DNAK_CARRP Chaperone protein DnaK OS=Carsonella ruddii (strain PV) GN=dnaK PE=3 SV=1 3 405 5.0E-61
sp|B1XRU1|DNAK_POLNS Chaperone protein DnaK OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=dnaK PE=3 SV=1 3 382 6.0E-61
sp|P48209|DNAK_HAEDU Chaperone protein DnaK OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaK PE=3 SV=2 3 520 6.0E-61
sp|B6IZJ0|DNAK_COXB2 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaK PE=3 SV=1 3 520 6.0E-61
sp|C6DF10|DNAK_PECCP Chaperone protein DnaK OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaK PE=3 SV=1 3 470 6.0E-61
sp|Q1GKS3|DNAK_RUEST Chaperone protein DnaK OS=Ruegeria sp. (strain TM1040) GN=dnaK PE=3 SV=1 3 405 7.0E-61
sp|A8G9K8|DNAK_SERP5 Chaperone protein DnaK OS=Serratia proteamaculans (strain 568) GN=dnaK PE=3 SV=1 3 495 7.0E-61
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 2 382 7.0E-61
sp|Q3J7D8|DNAK_NITOC Chaperone protein DnaK OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaK PE=3 SV=1 3 495 8.0E-61
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 3 381 8.0E-61
sp|Q98DD1|DNAK_RHILO Chaperone protein DnaK OS=Rhizobium loti (strain MAFF303099) GN=dnaK PE=3 SV=1 3 405 8.0E-61
sp|A6LDG8|DNAK_PARD8 Chaperone protein DnaK OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=dnaK PE=3 SV=1 3 495 9.0E-61
sp|Q5ZLK7|HYOU1_CHICK Hypoxia up-regulated protein 1 OS=Gallus gallus GN=HYOU1 PE=2 SV=1 1 436 1.0E-60
sp|Q7VQL4|DNAK_BLOFL Chaperone protein DnaK OS=Blochmannia floridanus GN=dnaK PE=3 SV=1 3 468 1.0E-60
sp|C3LTA5|DNAK_VIBCM Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaK PE=3 SV=1 3 468 1.0E-60
sp|O34241|DNAK_VIBCH Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaK PE=3 SV=2 3 468 1.0E-60
sp|A5F361|DNAK_VIBC3 Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaK PE=3 SV=1 3 468 1.0E-60
sp|A0M353|DNAK_GRAFK Chaperone protein DnaK OS=Gramella forsetii (strain KT0803) GN=dnaK PE=3 SV=1 3 495 1.0E-60
sp|P0CS91|HSP77_YEASX Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1 2 495 1.0E-60
sp|A9W6R7|DNAK_METEP Chaperone protein DnaK OS=Methylobacterium extorquens (strain PA1) GN=dnaK PE=3 SV=1 3 532 1.0E-60
sp|P50020|DNAK1_SYNE7 Chaperone protein dnaK1 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK1 PE=3 SV=2 3 576 2.0E-60
sp|B8IHL3|DNAK_METNO Chaperone protein DnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=3 SV=1 3 381 2.0E-60
sp|Q4FPS9|DNAK_PSYA2 Chaperone protein DnaK OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaK PE=3 SV=1 3 677 2.0E-60
sp|Q6D0B7|DNAK_PECAS Chaperone protein DnaK OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaK PE=3 SV=1 3 470 2.0E-60
sp|B1ZGR1|DNAK_METPB Chaperone protein DnaK OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaK PE=3 SV=1 3 532 2.0E-60
sp|A9BNG5|DNAK_DELAS Chaperone protein DnaK OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaK PE=3 SV=1 3 544 2.0E-60
sp|B7KSZ4|DNAK_METC4 Chaperone protein DnaK OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaK PE=3 SV=1 3 532 2.0E-60
sp|Q21H36|DNAK_SACD2 Chaperone protein DnaK OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaK PE=3 SV=1 3 520 2.0E-60
sp|Q5N0G0|DNAK3_SYNP6 Chaperone protein DnaK 3 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK3 PE=3 SV=1 3 576 2.0E-60
sp|P0CS90|HSP77_YEAST Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSC1 PE=1 SV=1 2 495 2.0E-60
sp|B2VGR9|DNAK_ERWT9 Chaperone protein DnaK OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaK PE=3 SV=1 3 564 2.0E-60
sp|B2SGV8|DNAK_FRATM Chaperone protein DnaK OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=dnaK PE=3 SV=1 3 495 2.0E-60
sp|B9L8Z0|DNAK_NAUPA Chaperone protein DnaK OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=dnaK PE=3 SV=1 3 495 2.0E-60
sp|C5CU12|DNAK_VARPS Chaperone protein DnaK OS=Variovorax paradoxus (strain S110) GN=dnaK PE=3 SV=1 3 601 2.0E-60
sp|A4IX28|DNAK_FRATW Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaK PE=3 SV=1 3 495 2.0E-60
sp|A1WAR6|DNAK_ACISJ Chaperone protein DnaK OS=Acidovorax sp. (strain JS42) GN=dnaK PE=3 SV=1 3 582 3.0E-60
sp|A4SFB1|DNAK_CHLPM Chaperone protein DnaK OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaK PE=3 SV=1 3 381 3.0E-60
sp|A1U614|DNAK_MARHV Chaperone protein DnaK OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaK PE=3 SV=1 3 495 3.0E-60
sp|Q2NVZ1|DNAK_SODGM Chaperone protein DnaK OS=Sodalis glossinidius (strain morsitans) GN=dnaK PE=3 SV=1 3 405 3.0E-60
sp|Q2S307|DNAK_SALRD Chaperone protein DnaK OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaK PE=3 SV=1 3 493 3.0E-60
sp|O68191|DNAK_BURPS Chaperone protein DnaK OS=Burkholderia pseudomallei (strain K96243) GN=dnaK PE=3 SV=2 3 382 3.0E-60
sp|A3ND68|DNAK_BURP6 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 668) GN=dnaK PE=3 SV=1 3 382 3.0E-60
sp|A3NYX7|DNAK_BURP0 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1106a) GN=dnaK PE=3 SV=1 3 382 3.0E-60
sp|A1V0U6|DNAK_BURMS Chaperone protein DnaK OS=Burkholderia mallei (strain SAVP1) GN=dnaK PE=3 SV=1 3 382 3.0E-60
sp|Q62HD5|DNAK_BURMA Chaperone protein DnaK OS=Burkholderia mallei (strain ATCC 23344) GN=dnaK PE=3 SV=1 3 382 3.0E-60
sp|A2S565|DNAK_BURM9 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10229) GN=dnaK PE=3 SV=1 3 382 3.0E-60
sp|A3MN99|DNAK_BURM7 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10247) GN=dnaK PE=3 SV=1 3 382 3.0E-60
sp|B5ENA3|DNAK_ACIF5 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaK PE=3 SV=1 3 382 3.0E-60
sp|B7J7X9|DNAK_ACIF2 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaK PE=3 SV=1 3 382 3.0E-60
sp|A0K4S8|DNAK_BURCH Chaperone protein DnaK OS=Burkholderia cenocepacia (strain HI2424) GN=dnaK PE=3 SV=1 3 665 3.0E-60
sp|B1JW19|DNAK_BURCC Chaperone protein DnaK OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaK PE=3 SV=1 3 665 3.0E-60
sp|Q1BYX3|DNAK_BURCA Chaperone protein DnaK OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaK PE=3 SV=1 3 665 3.0E-60
sp|Q6AMQ3|DNAK_DESPS Chaperone protein DnaK OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaK PE=3 SV=1 3 533 3.0E-60
sp|Q3JP10|DNAK_BURP1 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1710b) GN=dnaK PE=3 SV=1 3 382 4.0E-60
sp|Q68XI2|DNAK_RICTY Chaperone protein DnaK OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dnaK PE=3 SV=1 3 527 4.0E-60
sp|Q4UJK7|DNAK_RICFE Chaperone protein DnaK OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dnaK PE=3 SV=2 3 527 4.0E-60
sp|A9HEA3|DNAK_GLUDA Chaperone protein DnaK OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaK PE=3 SV=1 3 434 4.0E-60
sp|B3ERN8|DNAK_AMOA5 Chaperone protein DnaK OS=Amoebophilus asiaticus (strain 5a2) GN=dnaK PE=3 SV=1 3 495 4.0E-60
sp|A5IDK8|DNAK_LEGPC Chaperone protein DnaK OS=Legionella pneumophila (strain Corby) GN=dnaK PE=3 SV=1 3 684 4.0E-60
sp|O32482|DNAK_LEGPN Chaperone protein DnaK OS=Legionella pneumophila GN=dnaK PE=3 SV=1 3 684 4.0E-60
sp|Q5ZTY3|DNAK_LEGPH Chaperone protein DnaK OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaK PE=3 SV=2 3 684 4.0E-60
sp|A5CX56|DNAK_VESOH Chaperone protein DnaK OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dnaK PE=3 SV=1 3 520 5.0E-60
sp|P57870|DNAK_PASMU Chaperone protein DnaK OS=Pasteurella multocida (strain Pm70) GN=dnaK PE=3 SV=1 3 468 5.0E-60
sp|C4L8Y5|DNAK_TOLAT Chaperone protein DnaK OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaK PE=3 SV=1 3 469 5.0E-60
sp|P59565|DNAK_BUCBP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaK PE=3 SV=1 3 469 5.0E-60
sp|Q39JC8|DNAK_BURL3 Chaperone protein DnaK OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaK PE=3 SV=1 3 382 5.0E-60
sp|Q5NPS6|DNAK_ZYMMO Chaperone protein DnaK OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaK PE=3 SV=1 3 405 6.0E-60
sp|B3EHR1|DNAK_CHLL2 Chaperone protein DnaK OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaK PE=3 SV=1 3 381 6.0E-60
sp|Q5X3M7|DNAK_LEGPA Chaperone protein DnaK OS=Legionella pneumophila (strain Paris) GN=dnaK PE=3 SV=1 3 684 6.0E-60
sp|A4JBS1|DNAK_BURVG Chaperone protein DnaK OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaK PE=3 SV=1 3 382 6.0E-60
sp|B2IBR4|DNAK_BEII9 Chaperone protein DnaK OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaK PE=3 SV=1 3 405 7.0E-60
sp|A4SQ25|DNAK_AERS4 Chaperone protein DnaK OS=Aeromonas salmonicida (strain A449) GN=dnaK PE=3 SV=1 3 586 7.0E-60
sp|Q5NFG7|DNAK_FRATT Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaK PE=3 SV=1 3 495 7.0E-60
sp|Q14GW9|DNAK_FRAT1 Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaK PE=3 SV=1 3 495 7.0E-60
sp|C1DD88|DNAK_LARHH Chaperone protein DnaK OS=Laribacter hongkongensis (strain HLHK9) GN=dnaK PE=3 SV=1 3 647 8.0E-60
sp|A3M8W9|DNAK_ACIBT Chaperone protein DnaK OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaK PE=3 SV=2 3 663 8.0E-60
sp|B2HZZ7|DNAK_ACIBC Chaperone protein DnaK OS=Acinetobacter baumannii (strain ACICU) GN=dnaK PE=3 SV=1 3 663 8.0E-60
sp|Q7VIE3|DNAK_HELHP Chaperone protein DnaK OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dnaK PE=3 SV=1 3 470 8.0E-60
sp|Q8GUM2|HSP7I_ARATH Heat shock 70 kDa protein 9, mitochondrial OS=Arabidopsis thaliana GN=HSP70-9 PE=2 SV=1 3 381 9.0E-60
sp|B0V5U4|DNAK_ACIBY Chaperone protein DnaK OS=Acinetobacter baumannii (strain AYE) GN=dnaK PE=3 SV=1 3 382 1.0E-59
sp|B7IBK5|DNAK_ACIB5 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB0057) GN=dnaK PE=3 SV=1 3 382 1.0E-59
sp|B7H317|DNAK_ACIB3 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaK PE=3 SV=1 3 382 1.0E-59
sp|Q1Q7X0|DNAK_PSYCK Chaperone protein DnaK OS=Psychrobacter cryohalolentis (strain K5) GN=dnaK PE=3 SV=1 3 495 1.0E-59
sp|A4SZR8|DNAK_POLSQ Chaperone protein DnaK OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=dnaK PE=3 SV=1 3 382 1.0E-59
sp|A8FYU0|DNAK_SHESH Chaperone protein DnaK OS=Shewanella sediminis (strain HAW-EB3) GN=dnaK PE=3 SV=1 3 470 1.0E-59
sp|A0Q7F0|DNAK_FRATN Chaperone protein DnaK OS=Francisella tularensis subsp. novicida (strain U112) GN=dnaK PE=3 SV=1 3 495 1.0E-59
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 3 381 1.0E-59
sp|Q0BLK4|DNAK_FRATO Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dnaK PE=3 SV=1 3 495 1.0E-59
sp|Q2A328|DNAK_FRATH Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaK PE=3 SV=1 3 495 1.0E-59
sp|A7NCM9|DNAK_FRATF Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dnaK PE=3 SV=1 3 495 1.0E-59
sp|Q0BI18|DNAK_BURCM Chaperone protein DnaK OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaK PE=3 SV=1 3 382 1.0E-59
sp|A5FGL1|DNAK_FLAJ1 Chaperone protein DnaK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dnaK PE=3 SV=1 3 468 1.0E-59
sp|Q5WV15|DNAK_LEGPL Chaperone protein DnaK OS=Legionella pneumophila (strain Lens) GN=dnaK PE=3 SV=1 3 684 1.0E-59
sp|B1YTK0|DNAK_BURA4 Chaperone protein DnaK OS=Burkholderia ambifaria (strain MC40-6) GN=dnaK PE=3 SV=1 3 382 1.0E-59
sp|A7IC65|DNAK_XANP2 Chaperone protein DnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=3 SV=1 3 468 1.0E-59
sp|Q1LST3|DNAK_BAUCH Chaperone protein DnaK OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=dnaK PE=3 SV=1 3 405 2.0E-59
sp|Q5E4T4|DNAK1_VIBF1 Chaperone protein DnaK 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaK1 PE=3 SV=1 3 564 2.0E-59
sp|A9AGB8|DNAK_BURM1 Chaperone protein DnaK OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaK PE=3 SV=1 3 382 2.0E-59
sp|B4F2V5|DNAK_PROMH Chaperone protein DnaK OS=Proteus mirabilis (strain HI4320) GN=dnaK PE=3 SV=1 3 469 2.0E-59
sp|B6IVA4|DNAK_RHOCS Chaperone protein DnaK OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaK PE=3 SV=1 3 533 2.0E-59
sp|P48205|DNAK_FRATU Chaperone protein DnaK OS=Francisella tularensis GN=dnaK PE=3 SV=1 3 495 2.0E-59
sp|A1AW22|DNAK_RUTMC Chaperone protein DnaK OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaK PE=3 SV=1 3 520 2.0E-59
sp|B3CNB5|DNAK_WOLPP Chaperone protein DnaK OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dnaK PE=3 SV=1 4 405 2.0E-59
sp|P95334|DNAK_MYXXD Chaperone protein DnaK OS=Myxococcus xanthus (strain DK 1622) GN=dnaK PE=3 SV=2 3 628 2.0E-59
sp|Q2VYT1|DNAK_MAGSA Chaperone protein DnaK OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaK PE=3 SV=1 3 405 2.0E-59
sp|Q3IC08|DNAK_PSEHT Chaperone protein DnaK OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaK PE=3 SV=1 3 520 2.0E-59
sp|Q12Q08|DNAK_SHEDO Chaperone protein DnaK OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaK PE=3 SV=1 3 520 2.0E-59
sp|Q72IK5|DNAK_THET2 Chaperone protein DnaK OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaK PE=3 SV=1 4 468 2.0E-59
sp|B4EDZ2|DNAK_BURCJ Chaperone protein DnaK OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaK PE=3 SV=1 3 382 3.0E-59
sp|B9MDJ7|DNAK_ACIET Chaperone protein DnaK OS=Acidovorax ebreus (strain TPSY) GN=dnaK PE=3 SV=1 3 582 3.0E-59
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 2 495 3.0E-59
sp|B0TYF2|DNAK_FRAP2 Chaperone protein DnaK OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaK PE=3 SV=1 3 495 3.0E-59
sp|Q56235|DNAK_THET8 Chaperone protein DnaK OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaK PE=3 SV=2 4 468 3.0E-59
sp|Q145F1|DNAK_BURXL Chaperone protein DnaK OS=Burkholderia xenovorans (strain LB400) GN=dnaK PE=3 SV=1 3 382 3.0E-59
sp|B3EKT9|DNAK_CHLPB Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain BS1) GN=dnaK PE=3 SV=1 3 382 3.0E-59
sp|Q8KML6|DNAK_LACSN Chaperone protein DnaK OS=Lactobacillus sanfranciscensis GN=dnaK PE=3 SV=1 3 495 4.0E-59
sp|P48741|HSP77_HUMAN Putative heat shock 70 kDa protein 7 OS=Homo sapiens GN=HSPA7 PE=5 SV=2 4 342 4.0E-59
sp|Q2SYZ4|DNAK_BURTA Chaperone protein DnaK OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaK PE=3 SV=1 3 382 4.0E-59
sp|Q313S2|DNAK_DESAG Chaperone protein DnaK OS=Desulfovibrio alaskensis (strain G20) GN=dnaK PE=3 SV=1 3 495 4.0E-59
sp|Q9L7Z1|DNAK_VIBPR Chaperone protein DnaK OS=Vibrio proteolyticus GN=dnaK PE=3 SV=1 3 469 4.0E-59
sp|Q31HA7|DNAK_THICR Chaperone protein DnaK OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaK PE=3 SV=1 3 434 4.0E-59
sp|Q8DKR6|DNAK1_THEEB Chaperone protein dnaK1 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK1 PE=3 SV=1 3 434 5.0E-59
sp|B8EIP9|DNAK_METSB Chaperone protein DnaK OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dnaK PE=3 SV=1 3 405 6.0E-59
sp|A6GXZ1|DNAK_FLAPJ Chaperone protein DnaK OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=dnaK PE=3 SV=1 3 468 6.0E-59
sp|Q7N8Y4|DNAK_PHOLL Chaperone protein DnaK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaK PE=3 SV=1 3 470 6.0E-59
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 3 381 6.0E-59
sp|B1KRT2|DNAK_SHEWM Chaperone protein DnaK OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaK PE=3 SV=1 3 469 6.0E-59
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 3 381 6.0E-59
sp|B8J402|DNAK_DESDA Chaperone protein DnaK OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=dnaK PE=3 SV=1 3 405 6.0E-59
sp|Q01100|DNAK_HALMA Chaperone protein DnaK OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dnaK PE=3 SV=2 3 495 7.0E-59
sp|A1TLH9|DNAK_ACIAC Chaperone protein DnaK OS=Acidovorax citrulli (strain AAC00-1) GN=dnaK PE=3 SV=1 3 590 7.0E-59
sp|Q1QSX0|DNAK_CHRSD Chaperone protein DnaK OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaK PE=3 SV=1 3 520 7.0E-59
sp|Q7V9G2|DNAK2_PROMA Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK2 PE=3 SV=1 3 544 7.0E-59
sp|A5N6M2|DNAK_CLOK5 Chaperone protein DnaK OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaK PE=3 SV=1 3 526 7.0E-59
sp|B9E041|DNAK_CLOK1 Chaperone protein DnaK OS=Clostridium kluyveri (strain NBRC 12016) GN=dnaK PE=3 SV=1 3 526 7.0E-59
sp|B4S0U1|DNAK_ALTMD Chaperone protein DnaK OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=dnaK PE=3 SV=1 3 564 8.0E-59
sp|A0T0X1|DNAK_THAPS Chaperone protein dnaK OS=Thalassiosira pseudonana GN=dnaK PE=3 SV=1 3 493 9.0E-59
sp|Q28VY3|DNAK_JANSC Chaperone protein DnaK OS=Jannaschia sp. (strain CCS1) GN=dnaK PE=3 SV=1 3 468 9.0E-59
sp|B2SXC6|DNAK_BURPP Chaperone protein DnaK OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaK PE=3 SV=1 3 382 9.0E-59
sp|Q0HY11|DNAK_SHESR Chaperone protein DnaK OS=Shewanella sp. (strain MR-7) GN=dnaK PE=3 SV=1 3 469 9.0E-59
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 3 470 9.0E-59
sp|Q7MN85|DNAK_VIBVY Chaperone protein DnaK OS=Vibrio vulnificus (strain YJ016) GN=dnaK PE=3 SV=1 3 453 1.0E-58
sp|Q8DF66|DNAK_VIBVU Chaperone protein DnaK OS=Vibrio vulnificus (strain CMCP6) GN=dnaK PE=3 SV=1 3 453 1.0E-58
sp|Q8TQR2|DNAK_METAC Chaperone protein DnaK OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaK PE=3 SV=1 3 532 1.0E-58
sp|Q5E3A7|DNAK2_VIBF1 Chaperone protein DnaK 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaK2 PE=3 SV=1 3 520 1.0E-58
sp|Q65U55|DNAK_MANSM Chaperone protein DnaK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaK PE=3 SV=2 3 468 1.0E-58
sp|Q0HLN0|DNAK_SHESM Chaperone protein DnaK OS=Shewanella sp. (strain MR-4) GN=dnaK PE=3 SV=1 3 469 1.0E-58
sp|B6YRF7|DNAK_AZOPC Chaperone protein DnaK OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=dnaK PE=3 SV=1 3 468 1.0E-58
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 3 468 1.0E-58
sp|A6L2X7|DNAK_BACV8 Chaperone protein DnaK OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=dnaK PE=3 SV=1 3 495 1.0E-58
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 3 685 1.0E-58
sp|Q1AXX6|DNAK_RUBXD Chaperone protein DnaK OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=dnaK PE=3 SV=1 4 520 1.0E-58
sp|C3L3G7|DNAK_CLOB6 Chaperone protein DnaK OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dnaK PE=3 SV=1 3 495 1.0E-58
sp|P71331|DNAK_AGGAC Chaperone protein DnaK OS=Aggregatibacter actinomycetemcomitans GN=dnaK PE=3 SV=3 3 468 1.0E-58
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 3 520 1.0E-58
sp|Q7W519|DNAK_BORPA Chaperone protein DnaK OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaK PE=3 SV=1 3 468 1.0E-58
sp|Q94738|HSP97_STRFN 97 kDa heat shock protein OS=Strongylocentrotus franciscanus GN=HSP110 PE=2 SV=1 500 673 2.0E-17
sp|Q06068|HSP97_STRPU 97 kDa heat shock protein OS=Strongylocentrotus purpuratus PE=1 SV=2 548 663 4.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0000902 cell morphogenesis Yes
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0048869 cellular developmental process No
GO:0009653 anatomical structure morphogenesis No
GO:0016043 cellular component organization No
GO:0032989 cellular component morphogenesis No
GO:0032502 developmental process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4317
MSVVGVDFGTLKTVVAVARNRGVDVITNEVSNRATPSLVGFGPKSRYLGEAAKTQEISNLKNTVGCLKRLAGRSF
HDPDVQIEQQYITAPLVDVNGQVGAEVSYLDNREKFTATQMVGMFLSKIKQTAADELKLPVSDLCMSVPAWFTDV
QRRALLDAAEIAGVKLLRLMNDTTAAALGWGITKLDLPSPEERPRRVCFVDIGHSNYTCSVVEFKKGELAVKATA
WDRNFGGRDFDKALVDHLAKEFKMKYKVDIHTHGRAMARTIAAAEKTKKILSANQQAPVNIESLMNDIDASAMVT
RQEFEAMIEPLLNRAHIPLEHALTQAKISKDNIDAIEIVGGGSRVPALKDRIQSFFGKTLSYTMNADEAVARGCA
FSCAILSPVFRVRDFSVQDIISYPIDFAWEKAPDIPDEDTSLTVFNKGNVLPSTKILTFYRKQPFDLEARFTHPE
ELPGKMNPWIGRFSVKGVKAEAKDDFMICKLKARVNIHGVLNVESGYFVEDQEVDEEVKDEDLKDDGDKKDLDAM
ETDSKDEGPKKTRRVKKQIRKGDLPISSGTSSLDVGIKSTLIEQEANMVMEDKLVADTEEKKNELETFIYDLRAK
LDDQYAEFAGEEEKTTIKQKLETAEEWLYDEGDDASKGVYVAKLDELRAMAGPIVQRHFEKVEADRKAAQERLDA
EQAAKKTAEEEARKALQAQNKAVHQGVNDQDMTEAEIQEAGLEEAADPH*
Coding >Hirsu2|4317
ATGAGCGTCGTGGGTGTCGATTTCGGAACCCTGAAGACAGTTGTGGCTGTTGCGAGAAATCGCGGCGTGGACGTG
ATCACGAACGAGGTGTCCAACAGAGCTACACCGTCTCTGGTGGGCTTTGGACCGAAATCGCGCTACCTCGGTGAG
GCTGCCAAGACGCAGGAGATCTCCAACCTCAAGAACACCGTCGGCTGCCTCAAGCGTCTTGCCGGCCGTTCCTTC
CATGACCCCGATGTTCAGATTGAACAGCAGTACATCACTGCACCACTCGTCGACGTGAATGGCCAGGTCGGTGCT
GAGGTCTCCTACCTCGACAACAGGGAGAAATTCACGGCGACCCAGATGGTAGGCATGTTCTTGAGTAAGATCAAA
CAGACCGCTGCCGATGAACTCAAACTACCCGTATCGGATCTTTGCATGAGTGTCCCTGCTTGGTTCACCGATGTC
CAGCGCCGAGCCCTACTCGATGCTGCCGAGATTGCCGGCGTCAAGCTCTTGCGCCTCATGAATGACACCACTGCC
GCCGCTCTTGGCTGGGGTATCACCAAACTTGACCTTCCCAGCCCCGAGGAGCGTCCTCGTCGCGTGTGCTTCGTC
GACATCGGTCACAGCAACTATACCTGCTCCGTCGTCGAGTTCAAAAAGGGCGAGCTTGCTGTAAAAGCCACTGCT
TGGGATAGAAATTTTGGTGGTCGAGACTTCGACAAGGCCCTGGTCGACCATCTGGCCAAGGAGTTCAAGATGAAG
TATAAAGTGGACATACACACTCACGGACGGGCCATGGCCCGCACCATTGCTGCTGCCGAAAAGACGAAGAAGATC
CTCTCCGCCAACCAGCAGGCCCCTGTCAACATAGAGTCACTCATGAATGACATTGACGCCTCCGCTATGGTCACC
CGACAGGAGTTCGAGGCGATGATTGAGCCACTACTGAACCGCGCTCACATCCCGCTCGAGCACGCCCTCACCCAG
GCCAAAATCTCCAAGGACAACATCGATGCCATTGAGATAGTCGGCGGCGGCTCGCGTGTCCCAGCGCTCAAGGAC
CGCATACAGTCATTCTTCGGAAAGACTCTGTCCTACACCATGAACGCCGACGAAGCTGTGGCTCGTGGTTGCGCA
TTCAGCTGTGCTATTCTCTCGCCCGTCTTCCGGGTCCGCGACTTTTCTGTACAGGACATCATCAGCTACCCCATC
GACTTCGCCTGGGAGAAAGCTCCCGATATTCCCGACGAGGACACCAGCCTGACTGTCTTTAACAAAGGAAACGTC
TTGCCCTCGACCAAGATCTTAACCTTTTACCGTAAACAGCCGTTCGATCTCGAGGCCCGTTTCACACACCCTGAA
GAGCTTCCGGGGAAGATGAACCCCTGGATTGGGCGCTTCTCCGTCAAAGGCGTCAAGGCTGAGGCCAAAGACGAC
TTCATGATCTGCAAACTCAAAGCCAGGGTCAACATTCATGGTGTCTTGAATGTCGAGAGTGGCTACTTCGTTGAA
GACCAAGAGGTCGATGAGGAGGTCAAAGATGAGGATTTAAAAGACGATGGCGACAAGAAGGACCTCGACGCCATG
GAAACAGACAGCAAGGACGAAGGCCCCAAAAAGACTCGCAGAGTGAAAAAACAAATCCGCAAGGGCGATCTCCCC
ATTTCTAGCGGTACCTCATCTCTAGACGTCGGCATCAAGTCTACACTGATAGAACAGGAAGCCAACATGGTCATG
GAGGATAAACTTGTTGCCGATACGGAAGAAAAGAAGAATGAGTTGGAAACGTTTATTTATGACCTCAGAGCAAAA
TTGGACGATCAGTACGCTGAATTTGCCGGCGAAGAGGAGAAGACGACTATAAAGCAAAAGCTCGAGACTGCCGAG
GAGTGGCTTTATGACGAGGGTGACGACGCGTCCAAAGGCGTCTACGTCGCCAAGCTGGACGAGCTTCGTGCCATG
GCGGGACCCATAGTTCAACGTCATTTTGAAAAGGTTGAGGCGGACCGGAAGGCGGCTCAAGAACGCCTCGACGCC
GAGCAGGCGGCCAAAAAAACCGCCGAGGAGGAAGCTCGCAAAGCTTTACAAGCTCAAAACAAGGCGGTCCATCAA
GGAGTAAACGACCAAGACATGACGGAGGCAGAGATTCAGGAAGCTGGATTGGAAGAAGCCGCTGATCCCCATTAG
Transcript >Hirsu2|4317
ATGAGCGTCGTGGGTGTCGATTTCGGAACCCTGAAGACAGTTGTGGCTGTTGCGAGAAATCGCGGCGTGGACGTG
ATCACGAACGAGGTGTCCAACAGAGCTACACCGTCTCTGGTGGGCTTTGGACCGAAATCGCGCTACCTCGGTGAG
GCTGCCAAGACGCAGGAGATCTCCAACCTCAAGAACACCGTCGGCTGCCTCAAGCGTCTTGCCGGCCGTTCCTTC
CATGACCCCGATGTTCAGATTGAACAGCAGTACATCACTGCACCACTCGTCGACGTGAATGGCCAGGTCGGTGCT
GAGGTCTCCTACCTCGACAACAGGGAGAAATTCACGGCGACCCAGATGGTAGGCATGTTCTTGAGTAAGATCAAA
CAGACCGCTGCCGATGAACTCAAACTACCCGTATCGGATCTTTGCATGAGTGTCCCTGCTTGGTTCACCGATGTC
CAGCGCCGAGCCCTACTCGATGCTGCCGAGATTGCCGGCGTCAAGCTCTTGCGCCTCATGAATGACACCACTGCC
GCCGCTCTTGGCTGGGGTATCACCAAACTTGACCTTCCCAGCCCCGAGGAGCGTCCTCGTCGCGTGTGCTTCGTC
GACATCGGTCACAGCAACTATACCTGCTCCGTCGTCGAGTTCAAAAAGGGCGAGCTTGCTGTAAAAGCCACTGCT
TGGGATAGAAATTTTGGTGGTCGAGACTTCGACAAGGCCCTGGTCGACCATCTGGCCAAGGAGTTCAAGATGAAG
TATAAAGTGGACATACACACTCACGGACGGGCCATGGCCCGCACCATTGCTGCTGCCGAAAAGACGAAGAAGATC
CTCTCCGCCAACCAGCAGGCCCCTGTCAACATAGAGTCACTCATGAATGACATTGACGCCTCCGCTATGGTCACC
CGACAGGAGTTCGAGGCGATGATTGAGCCACTACTGAACCGCGCTCACATCCCGCTCGAGCACGCCCTCACCCAG
GCCAAAATCTCCAAGGACAACATCGATGCCATTGAGATAGTCGGCGGCGGCTCGCGTGTCCCAGCGCTCAAGGAC
CGCATACAGTCATTCTTCGGAAAGACTCTGTCCTACACCATGAACGCCGACGAAGCTGTGGCTCGTGGTTGCGCA
TTCAGCTGTGCTATTCTCTCGCCCGTCTTCCGGGTCCGCGACTTTTCTGTACAGGACATCATCAGCTACCCCATC
GACTTCGCCTGGGAGAAAGCTCCCGATATTCCCGACGAGGACACCAGCCTGACTGTCTTTAACAAAGGAAACGTC
TTGCCCTCGACCAAGATCTTAACCTTTTACCGTAAACAGCCGTTCGATCTCGAGGCCCGTTTCACACACCCTGAA
GAGCTTCCGGGGAAGATGAACCCCTGGATTGGGCGCTTCTCCGTCAAAGGCGTCAAGGCTGAGGCCAAAGACGAC
TTCATGATCTGCAAACTCAAAGCCAGGGTCAACATTCATGGTGTCTTGAATGTCGAGAGTGGCTACTTCGTTGAA
GACCAAGAGGTCGATGAGGAGGTCAAAGATGAGGATTTAAAAGACGATGGCGACAAGAAGGACCTCGACGCCATG
GAAACAGACAGCAAGGACGAAGGCCCCAAAAAGACTCGCAGAGTGAAAAAACAAATCCGCAAGGGCGATCTCCCC
ATTTCTAGCGGTACCTCATCTCTAGACGTCGGCATCAAGTCTACACTGATAGAACAGGAAGCCAACATGGTCATG
GAGGATAAACTTGTTGCCGATACGGAAGAAAAGAAGAATGAGTTGGAAACGTTTATTTATGACCTCAGAGCAAAA
TTGGACGATCAGTACGCTGAATTTGCCGGCGAAGAGGAGAAGACGACTATAAAGCAAAAGCTCGAGACTGCCGAG
GAGTGGCTTTATGACGAGGGTGACGACGCGTCCAAAGGCGTCTACGTCGCCAAGCTGGACGAGCTTCGTGCCATG
GCGGGACCCATAGTTCAACGTCATTTTGAAAAGGTTGAGGCGGACCGGAAGGCGGCTCAAGAACGCCTCGACGCC
GAGCAGGCGGCCAAAAAAACCGCCGAGGAGGAAGCTCGCAAAGCTTTACAAGCTCAAAACAAGGCGGTCCATCAA
GGAGTAAACGACCAAGACATGACGGAGGCAGAGATTCAGGAAGCTGGATTGGAAGAAGCCGCTGATCCCCATTAG
Gene >Hirsu2|4317
ATGAGCGTCGTGGGTGGGTTGTGCCGCTCCCCGGCCTGCATTACTGGCGAAACCGCCGAAAGTGCTGACACAAAT
ACCTATTAGGTGTCGATTTCGGAACCCTGAAGACAGTTGTGGCTGTTGCGAGAAATCGCGGCGTGGACGTGGTGC
GTGCCCATCAACGCCTAGCCAACCTAATGATGGGTTCTCGGCAGTTGACCACAATATCTGCCGTAGATCACGAAC
GAGGTGTCCAACAGAGCTACACCGTGCGTTACGGAGGCTCTTTCCGAGCGAGACCCCTAGTATAGACATCCTTTG
GCTGACAGGATCGTCGTTACAGGTCTCTGGTGGGCTTTGGACCGAAATCGCGCTACCTCGGTGAGGCTGCCAAGA
CGCAGGAGATCTCCAACCTCAAGAACACCGTCGGCTGCCTCAAGCGTCTTGCCGGCCGTTCCTTCCATGACCCCG
ATGTTCAGATTGAACAGCAGTACATCACTGCACCACTCGTCGACGTGAATGGCCAGGTCGGTGCTGAGGTCTCCT
ACCTCGACAACAGGGAGAAATTCACGGCGACCCAGATGGTAGGCATGTTCTTGAGTAAGATCAAACAGACCGCTG
CCGATGAACTCAAACTACCCGTATCGGATCTTTGCATGAGTGTCCCTGCTTGGTTCACCGATGTCCAGCGCCGAG
CCCTACTCGATGCTGCCGAGATTGCCGGCGTCAAGCTCTTGCGCCTCATGAATGACACCACTGCCGCCGCTCTTG
GCTGGGGTATCACCAAACTTGACCTTCCCAGCCCCGAGGAGCGTCCTCGTCGCGTGTGCTTCGTCGACATCGGTC
ACAGCAACTATACCTGCTCCGTCGTCGAGTTCAAAAAGGGCGAGCTTGCTGTAAAAGCCACTGCTTGGGATAGAA
ATTTTGGTGGTCGAGACTTCGACAAGGCCCTGGTCGACCATCTGGCCAAGGAGTTCAAGATGAAGTATAAAGTGG
ACATACACACTCACGGACGGGCCATGGCCCGCACCATTGCTGCTGCCGAAAAGACGAAGAAGATCCTCTCCGCCA
ACCAGCAGGCCCCTGTCAACATAGAGTCACTCATGAATGACATTGACGCCTCCGCTATGGTCACCCGACAGGAGT
TCGAGGCGATGATTGAGCCACTACTGAACCGCGCTCACATCCCGCTCGAGCACGCCCTCACCCAGGCCAAAATCT
CCAAGGACAACATCGATGCCATTGAGATAGTCGGCGGCGGCTCGCGTGTCCCAGCGCTCAAGGACCGCATACAGT
CATTCTTCGGAAAGACTCTGTCCTACACCATGAACGCCGACGAAGCTGTGGCTCGTGGTTGCGCATTCAGCTGTG
CTATTCTCTCGCCCGTCTTCCGGGTCCGCGACTTTTCTGTACAGGACATCATCAGCTACCCCATCGACTTCGCCT
GGGAGAAAGCTCCCGATATTCCCGACGAGGACACCAGCCTGACTGTCTTTAACAAAGGAAACGTCTTGCCCTCGA
CCAAGATCTTAACCTTTTACCGTAAACAGCCGTTCGATCTCGAGGCCCGTTTCACACACCCTGAAGAGCTTCCGG
GGAAGATGAACCCCTGGATTGGGCGCTTCTCCGTCAAAGGCGTCAAGGCTGAGGCCAAAGACGACTTCATGATCT
GCAAACTCAAAGCCAGGGTCAACATTCATGGTGTCTTGAATGTCGAGAGTGGCTACTTCGTTGAAGACCAAGAGG
TCGATGAGGAGGTCAAAGATGAGGATTTAAAAGACGATGGCGACAAGAAGGACCTCGACGTAAGTGCGGATCCTC
TCCTTTCGCTTGACCTCAGCGCCTCTATATGGTTCGGATCTCGCGCTATCGTCCATTGCTAAGTCAACGGTGTCG
AAATTCATCGTTCCTGATGTGTTCTTTGCTGCCTTCTCACGGCCCTAATACGTTGCACTCGTCTTTCTTGTTGAG
CGGCTCGTTGATTCAAATTCCCGCTGATGGGTGACTTTGGCTAACCATGTTTTCCTCTCAGGCCATGGAAACAGA
CAGCAAGGACGAAGGCCCCAAAAAGACTCGCAGAGTGAAAAAACAAATCCGCAAGGGCGATCTCCCCATTTCTAG
CGGTACCTCATCTCTAGACGTCGGCATCAAGTCTACACTGATAGAACAGGAAGCCAACATGGTCATGGAGGATAA
ACTTGTTGCCGATACGGAAGAAAAGAAGAATGAGTTGGAAACGTTTATTTATGACCTCAGAGCAAAATTGGACGA
TCAGTACGCTGAATTTGCCGGCGAAGAGGAGAAGACGACTATAAAGCAAAAGCTCGAGACTGCCGAGGTCGGTTC
TTACCCCCCTGATCACAGATCTGATGGCGTTTTGTGTTCTAGCCCCTTGACTAACACGTAGCCTGACACTGATGA
CAGGAGTGGCTTTATGACGAGGGTGACGACGCGTCCAAAGGCGTCTACGTCGCCAAGCTGGACGAGCTTCGTGCC
ATGGCGGGACCCATAGTTCAACGTCATTTTGAAAAGGTTGAGGCGGACCGGAAGGCGGCTCAAGAACGCCTCGAC
GCCGAGCAGGCGGCCAAAAAAACCGCCGAGGAGGAAGCTCGCAAAGCTTTACAAGCTCAAAACAAGGCGGTCCAT
CAAGGAGTAAACGACCAAGACATGACGGAGGCAGAGATTCAGGAAGCTGGATTGGAAGAAGCCGCTGATCCCCAT
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail