Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4305
Gene name
LocationContig_220:13413..13831
Strand+
Gene length (bp)418
Transcript length (bp)219
Coding sequence length (bp)219
Protein length (aa) 73

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06842 DUF1242 Protein of unknown function (DUF1242) 7.4E-16 10 44

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CR64|KISHA_MOUSE Protein kish-A OS=Mus musculus GN=Tmem167a PE=1 SV=1 1 69 1.0E-23
sp|Q5ZII6|KISHA_CHICK Protein kish-A OS=Gallus gallus GN=TMEM167A PE=3 SV=1 1 69 2.0E-23
sp|B5G2S6|KISHA_TAEGU Protein kish-A OS=Taeniopygia guttata GN=TMEM167A PE=3 SV=1 1 69 2.0E-23
sp|Q5RAL1|KISHA_PONAB Protein kish-A OS=Pongo abelii GN=TMEM167A PE=3 SV=1 1 69 4.0E-23
sp|Q8TBQ9|KISHA_HUMAN Protein kish-A OS=Homo sapiens GN=TMEM167A PE=1 SV=1 1 69 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CR64|KISHA_MOUSE Protein kish-A OS=Mus musculus GN=Tmem167a PE=1 SV=1 1 69 1.0E-23
sp|Q5ZII6|KISHA_CHICK Protein kish-A OS=Gallus gallus GN=TMEM167A PE=3 SV=1 1 69 2.0E-23
sp|B5G2S6|KISHA_TAEGU Protein kish-A OS=Taeniopygia guttata GN=TMEM167A PE=3 SV=1 1 69 2.0E-23
sp|Q5RAL1|KISHA_PONAB Protein kish-A OS=Pongo abelii GN=TMEM167A PE=3 SV=1 1 69 4.0E-23
sp|Q8TBQ9|KISHA_HUMAN Protein kish-A OS=Homo sapiens GN=TMEM167A PE=1 SV=1 1 69 4.0E-23
sp|Q148I3|KISHA_BOVIN Protein kish-A OS=Bos taurus GN=TMEM167A PE=3 SV=1 1 69 4.0E-23
sp|Q5BJC2|KISHA_DANRE Protein kish-A OS=Danio rerio GN=tmem167a PE=3 SV=1 1 69 6.0E-23
sp|G2TRS3|KISH_SCHPO Protein kish OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksh1 PE=2 SV=1 1 71 3.0E-21
sp|A2VDC5|KISHA_XENLA Protein kish-A OS=Xenopus laevis GN=tmem167a PE=3 SV=1 1 69 8.0E-20
sp|Q28FL7|KISHA_XENTR Protein kish-A OS=Xenopus tropicalis GN=tmem167a PE=3 SV=2 1 69 1.0E-19
sp|Q8TGJ3|KISH_YEAST Protein kish OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSH1 PE=3 SV=1 1 67 2.0E-19
sp|Q9VWH8|KISH_DROME Protein kish OS=Drosophila melanogaster GN=ksh PE=3 SV=2 1 69 6.0E-17
sp|Q54HH9|KISH_DICDI Protein kish OS=Dictyostelium discoideum GN=tmem167 PE=3 SV=1 1 69 2.0E-09
sp|Q5RAU6|KISHB_PONAB Protein kish-B OS=Pongo abelii GN=TMEM167B PE=3 SV=1 1 69 7.0E-07
sp|Q9NRX6|KISHB_HUMAN Protein kish-B OS=Homo sapiens GN=TMEM167B PE=3 SV=1 1 69 7.0E-07
sp|Q80X45|KISHB_MOUSE Protein kish-B OS=Mus musculus GN=Tmem167b PE=3 SV=1 1 69 1.0E-06
sp|Q0IIL4|KISHB_BOVIN Protein kish-B OS=Bos taurus GN=TMEM167B PE=3 SV=1 1 69 1.0E-06
sp|Q28GL2|KISHB_XENTR Protein kish-B OS=Xenopus tropicalis GN=tmem167b PE=3 SV=1 1 69 5.0E-06
sp|Q6DE23|KISHB_XENLA Protein kish-B OS=Xenopus laevis GN=tmem167b PE=3 SV=1 1 69 5.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1535 0.1826 0.1464 0.357 0.5003 0.0309 0.8647 0.5833 0.4207 0.0111

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 49 71 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5232
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7442
Ophiocordyceps australis map64 (Brazil) OphauB2|6326
Ophiocordyceps camponoti-floridani Ophcf2|02592
Ophiocordyceps camponoti-rufipedis Ophun1|5954
Ophiocordyceps kimflemingae Ophio5|8051
Ophiocordyceps subramaniannii Hirsu2|4305 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4305
MSALFNLQSLMLVLLLLTCTSAYIHQIFPRILDSNKDGPLGILWKFARIGERMSPYICLACVFMAVSMLVGY*
Coding >Hirsu2|4305
ATGTCGGCCCTCTTCAACCTCCAGTCGCTCATGCTGGTGCTCCTCCTCCTGACCTGCACCTCTGCCTACATCCAC
CAAATATTCCCGCGAATTCTCGACTCGAACAAGGATGGGCCTCTGGGCATTCTCTGGAAGTTTGCGAGAATAGGG
GAGCGGATGAGCCCGTACATATGCTTGGCCTGCGTCTTCATGGCGGTGTCGATGCTGGTCGGCTATTGA
Transcript >Hirsu2|4305
ATGTCGGCCCTCTTCAACCTCCAGTCGCTCATGCTGGTGCTCCTCCTCCTGACCTGCACCTCTGCCTACATCCAC
CAAATATTCCCGCGAATTCTCGACTCGAACAAGGATGGGCCTCTGGGCATTCTCTGGAAGTTTGCGAGAATAGGG
GAGCGGATGAGCCCGTACATATGCTTGGCCTGCGTCTTCATGGCGGTGTCGATGCTGGTCGGCTATTGA
Gene >Hirsu2|4305
ATGGTAGGTCCTACGCTGCTGTTTTGTAGAACGTGCTTGGGTGCGCTAACCATCTCTCTTCCTTGGCAGTCGGCC
CTCTTCAACCTCCAGTCGCTCATGCTGGTGCTCCTCCTCCTGACCTGCACCTCTGCCTACATCCACCAAATATTC
CCGCGAATTCTCGACTCGAACAAGGATGGGTGCGTTTCCGCGAGCAGCAGCTTCGCGGGTATACCGCTCTGACGC
AGGAAGCAGGCCTCTGGGCATTCTCTGGAAGTTTGCGAGAATAGGGGAGCGGATGAGCCCGTACATATGCTTGGC
CTGCGTCTTCATGGCGGTAAGAGCCCGCCCCCATCTCCACGCCACGTGATTGTTGAAGCTGATGGACTGTCTGTC
TCGCTTCGTCTATGGCCAGGTGTCGATGCTGGTCGGCTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail