Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4302
Gene name
LocationContig_220:6093..7868
Strand+
Gene length (bp)1775
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.9E-15 87 353

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 5 394 3.0E-15
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 17 438 5.0E-14
sp|P37662|YHJX_ECOLI Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) GN=yhjX PE=1 SV=1 92 423 4.0E-11
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 18 460 5.0E-11
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 55 269 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 5 394 3.0E-15
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 17 438 5.0E-14
sp|P37662|YHJX_ECOLI Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) GN=yhjX PE=1 SV=1 92 423 4.0E-11
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 18 460 5.0E-11
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 55 269 7.0E-10
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 77 430 1.0E-09
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 54 470 2.0E-09
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 77 277 2.0E-09
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 47 470 2.0E-09
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 77 277 5.0E-09
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 51 452 7.0E-09
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 53 265 2.0E-08
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 16 466 3.0E-08
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 40 470 3.0E-08
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 133 450 3.0E-08
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 77 267 4.0E-08
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 141 452 4.0E-08
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 77 450 1.0E-07
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 77 267 1.0E-07
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 50 466 1.0E-07
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 104 335 2.0E-07
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 133 450 2.0E-07
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 77 431 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 78 100 22
2 113 135 22
3 147 169 22
4 173 195 22
5 202 224 22
6 234 256 22
7 277 299 22
8 309 331 22
9 338 360 22
10 375 397 22
11 404 426 22
12 441 463 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4302
MEVGNEKQQTAEPVFLPQRDEISSSSSSGTKTPPAAETTAPDEEKGQAGRRQEHEDEPEQQEGTPGSDDDDVDSW
RGWIVVAASSSSLFCYMGVIYSWGIVQAEIARQTGTSLTTLTFVGSLASSFMGSAAIPVGKAIRRWGYRRTALAG
AFLLGLGEFLSSWAVGHIGALFVTHGILFGLGGGLTVLPCSTAPLKRFRRHRGLAVGVVFGGSSLGAAVMAVATD
RLVRQVGVPWTFRVLGFLLWAVCLPAALCIGPPASSTEAVPRLQWYRWKEARFLVLLVGGLLTCFPLLVPPYFIP
IFARSISQSGSTGVIALTVWNLSSTVGRVVAGLAADSFLGPVNSTIVAVLCCGLSALVIWPFASDVAVLSLFSVV
SGIGCGAFFSLFPTVVGAVFGVGNVMAVLPMLWASWFFGYFFGTPIASRLYALAGTDADTTQYRPAAYYAGATSM
AGLIFIIILRCLLTKKLFVRV*
Coding >Hirsu2|4302
ATGGAAGTCGGAAACGAAAAGCAGCAGACGGCCGAGCCCGTCTTCTTGCCCCAAAGGGACGAGATCAGCAGCAGC
AGCAGCAGTGGGACGAAAACGCCGCCGGCCGCAGAGACTACCGCCCCAGACGAAGAAAAGGGACAGGCGGGACGG
CGACAGGAGCACGAGGACGAGCCGGAGCAGCAAGAGGGAACCCCAGGCTCGGACGACGATGACGTCGACAGTTGG
CGGGGCTGGATCGTTGTGGCCGCGTCGTCCAGCTCACTCTTCTGCTACATGGGCGTCATCTACTCGTGGGGCATT
GTGCAGGCCGAGATCGCGCGGCAGACGGGGACGTCGCTGACGACGCTGACCTTCGTCGGCTCGCTCGCCAGCTCC
TTTATGGGCTCCGCCGCCATCCCCGTCGGCAAGGCGATCCGCCGCTGGGGATACCGCCGCACCGCCCTGGCCGGC
GCCTTTCTGCTCGGCCTCGGCGAGTTCCTTTCCAGCTGGGCCGTCGGCCACATCGGCGCCCTGTTCGTCACGCAC
GGCATCCTCTTCGGCCTCGGCGGCGGCTTGACCGTCTTGCCCTGCTCGACGGCGCCGCTCAAGCGGTTCCGCCGG
CACCGCGGCCTCGCCGTCGGCGTCGTCTTCGGCGGCAGCAGCCTGGGCGCCGCCGTCATGGCCGTCGCCACCGAC
CGGCTCGTCCGCCAGGTCGGCGTTCCGTGGACCTTTCGCGTGCTCGGCTTCCTGCTGTGGGCCGTCTGCCTGCCG
GCCGCCTTGTGCATCGGCCCGCCGGCCTCGTCGACCGAGGCGGTCCCGCGACTACAATGGTACCGATGGAAGGAG
GCGCGGTTCCTCGTCCTGCTGGTCGGCGGCCTCCTGACCTGTTTCCCGCTGCTGGTGCCGCCCTACTTCATCCCC
ATCTTCGCGCGGTCCATCAGCCAGTCTGGCTCGACGGGCGTCATCGCCTTGACCGTTTGGAATCTGTCGTCGACC
GTCGGCCGCGTCGTGGCCGGCCTCGCCGCCGACTCCTTCCTCGGCCCCGTCAACAGCACCATCGTCGCCGTTCTG
TGCTGCGGCCTCAGCGCCCTGGTCATCTGGCCCTTCGCTTCCGACGTCGCCGTCCTCTCCCTCTTCTCCGTCGTC
AGCGGCATCGGCTGCGGCGCCTTCTTCAGCCTCTTCCCCACCGTCGTCGGCGCCGTCTTCGGCGTCGGCAACGTC
ATGGCCGTCCTGCCCATGCTGTGGGCCAGCTGGTTCTTCGGCTACTTCTTCGGCACGCCCATCGCTTCCCGCCTC
TACGCCCTGGCCGGCACCGATGCCGACACCACCCAGTACCGCCCAGCGGCTTACTATGCCGGAGCGACGTCCATG
GCCGGCCTCATCTTCATCATCATCCTGCGTTGTCTGCTCACGAAGAAGCTTTTCGTCCGAGTATAA
Transcript >Hirsu2|4302
ATGGAAGTCGGAAACGAAAAGCAGCAGACGGCCGAGCCCGTCTTCTTGCCCCAAAGGGACGAGATCAGCAGCAGC
AGCAGCAGTGGGACGAAAACGCCGCCGGCCGCAGAGACTACCGCCCCAGACGAAGAAAAGGGACAGGCGGGACGG
CGACAGGAGCACGAGGACGAGCCGGAGCAGCAAGAGGGAACCCCAGGCTCGGACGACGATGACGTCGACAGTTGG
CGGGGCTGGATCGTTGTGGCCGCGTCGTCCAGCTCACTCTTCTGCTACATGGGCGTCATCTACTCGTGGGGCATT
GTGCAGGCCGAGATCGCGCGGCAGACGGGGACGTCGCTGACGACGCTGACCTTCGTCGGCTCGCTCGCCAGCTCC
TTTATGGGCTCCGCCGCCATCCCCGTCGGCAAGGCGATCCGCCGCTGGGGATACCGCCGCACCGCCCTGGCCGGC
GCCTTTCTGCTCGGCCTCGGCGAGTTCCTTTCCAGCTGGGCCGTCGGCCACATCGGCGCCCTGTTCGTCACGCAC
GGCATCCTCTTCGGCCTCGGCGGCGGCTTGACCGTCTTGCCCTGCTCGACGGCGCCGCTCAAGCGGTTCCGCCGG
CACCGCGGCCTCGCCGTCGGCGTCGTCTTCGGCGGCAGCAGCCTGGGCGCCGCCGTCATGGCCGTCGCCACCGAC
CGGCTCGTCCGCCAGGTCGGCGTTCCGTGGACCTTTCGCGTGCTCGGCTTCCTGCTGTGGGCCGTCTGCCTGCCG
GCCGCCTTGTGCATCGGCCCGCCGGCCTCGTCGACCGAGGCGGTCCCGCGACTACAATGGTACCGATGGAAGGAG
GCGCGGTTCCTCGTCCTGCTGGTCGGCGGCCTCCTGACCTGTTTCCCGCTGCTGGTGCCGCCCTACTTCATCCCC
ATCTTCGCGCGGTCCATCAGCCAGTCTGGCTCGACGGGCGTCATCGCCTTGACCGTTTGGAATCTGTCGTCGACC
GTCGGCCGCGTCGTGGCCGGCCTCGCCGCCGACTCCTTCCTCGGCCCCGTCAACAGCACCATCGTCGCCGTTCTG
TGCTGCGGCCTCAGCGCCCTGGTCATCTGGCCCTTCGCTTCCGACGTCGCCGTCCTCTCCCTCTTCTCCGTCGTC
AGCGGCATCGGCTGCGGCGCCTTCTTCAGCCTCTTCCCCACCGTCGTCGGCGCCGTCTTCGGCGTCGGCAACGTC
ATGGCCGTCCTGCCCATGCTGTGGGCCAGCTGGTTCTTCGGCTACTTCTTCGGCACGCCCATCGCTTCCCGCCTC
TACGCCCTGGCCGGCACCGATGCCGACACCACCCAGTACCGCCCAGCGGCTTACTATGCCGGAGCGACGTCCATG
GCCGGCCTCATCTTCATCATCATCCTGCGTTGTCTGCTCACGAAGAAGCTTTTCGTCCGAGTATAA
Gene >Hirsu2|4302
ATGGAAGTCGGAAACGAAAAGCAGCAGACGGCCGAGCCCGTCTTCTTGCCCCAAAGGGACGAGATCAGCAGCAGC
AGCAGCAGTGGGACGAAAACGCCGCCGGCCGCAGAGACTACCGCCCCAGACGAAGAAAAGGGACAGGCGGGACGG
CGACAGGAGCACGAGGACGAGCCGGAGCAGCAAGAGGGAACCCCAGGCTCGGACGACGATGACGTCGACAGTTGG
CGGGGCTGGATCGTTGTGGCCGCGTCGTCCAGCTCACTCTTCTGCTACATGGGCGTCATCTACTCGTGGGGCATT
GTGCAGGCCGAGATCGCGCGGCAGACGGGGACGTCGCTGACGACGCTGACCTTCGTCGGCTCGCTCGCCAGCTCC
TTTATGGGCTCCGCCGCCATCCCCGTCGGCAAGGCGATCCGCCGCTGGGGATACCGCCGCACCGCCCTGGCCGGC
GCCTTTCTGCTCGGCCTCGGCGAGTTCCTTTCCAGCTGGGCCGTCGGCCACATCGGCGCCCTGTTCGTCACGCAC
GGCATCCTCTTCGGCCTCGGCGGCGGCTTGACCGTCTTGGTATGTTTTTCCTTGGTCTCTCCTGTTTTGCTTTAG
CCCCCTTCTTCTCTCGCTCTCGCACACACACAGCCCGTTCTGTCAAGGTCGGGAAAGAGAGCGAGGAGGAGGGGA
GACTGCCAAAAGCCCTCTCCGTGCTGCCGGCCAAGACTCGTCTGACGTCTCCCGCAGCCCTGCTCGACGGCGCCG
CTCAAGCGGTTCCGCCGGCACCGCGGCCTCGCCGTCGGCGTCGTCTTCGGCGGCAGCAGCCTGGGCGCCGCCGTC
ATGGCCGTCGCCACCGACCGGCTCGTCCGCCAGGTCGGCGTTCCGTGGACCTTTCGCGTGCTCGGCTTCCTGCTG
TGGGCCGTCTGCCTGCCGGCCGCCTTGTGCATCGGCCCGCCGGCCTCGTCGACCGAGGCGGTCCCGCGACTACAA
TGGTGTGAACCCCTCCCTCCCTCCACCGGGGATCTCCCTCGTCCGGATCAGACCGACAAGTGAAGAGAGGGGAAA
AGAAAGCGTCGTCCTGGTTCTTGTCAATGCTGACGACCTTCTCCCAAGGTACCGATGGAAGGAGGCGCGGTTCCT
CGTCCTGCTGGTCGGCGGCCTCCTGACCTGTTTCCCGCTGCTGGTGCCGCCCTACTTCATCCCCATCTTCGCGCG
GTCCATCAGCCAGTCTGGCTCGACGGGCGTCATCGCCTTGACCGTTTGGAATCTGTCGTCGACCGTCGGCCGCGT
CGTGGCCGGCCTCGCCGCCGACTCCTTCCTCGGCCCCGTCAACAGCACCATCGTCGCCGTTCTGTGCTGCGGCCT
CAGCGCCCTGGTCATCTGGCCCTTCGCTTCCGACGTCGCCGTCCTCTCCCTCTTCTCCGTCGTCAGCGGCATCGG
CTGCGGCGCCTTCTTCAGCCTCTTCCCCACCGTCGTCGGCGCCGTCTTCGGCGTCGGCAACGTCATGGCCGTCCT
GCCCATGCTGTGGGCCAGCTGGTTCTTCGGCTACTTCTTCGTGAGTCTTCCCTCCGCCCGGCCAGGCTCGGCCCA
GCGCTGGCGCTAATGCTGGAGGCTGCGACTTCCAGGGCACGCCCATCGCTTCCCGCCTCTACGCCCTGGCCGGCA
CCGATGCCGACACCACCCAGTACCGCCCAGCGGCTTACTATGCCGGAGCGACGTCCATGGCCGGCCTCATCTTCA
TCATCATCCTGCGTTGTCTGCTCACGAAGAAGCTTTTCGTCCGAGTATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail